BLASTX nr result
ID: Cimicifuga21_contig00033698
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00033698 (230 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF02855.1|AC009324_4 Similar to retrotransposon proteins [Ar... 63 3e-08 gb|AAK51235.1|AF287471_1 polyprotein [Arabidopsis thaliana] 59 5e-07 emb|CAA19714.1| putative protein [Arabidopsis thaliana] gi|72695... 57 1e-06 gb|AAC61290.1| putative retroelement pol polyprotein [Arabidopsi... 57 1e-06 emb|CAA19715.1| putative protein [Arabidopsis thaliana] gi|72695... 57 1e-06 >gb|AAF02855.1|AC009324_4 Similar to retrotransposon proteins [Arabidopsis thaliana] Length = 1522 Score = 62.8 bits (151), Expect = 3e-08 Identities = 30/48 (62%), Positives = 35/48 (72%) Frame = -3 Query: 228 G*SEKHKGYRSLYLPTGRVYVSRHVVFDENTFPFQKSSPPLSQPMDNT 85 G +EK+KGYR LY PTGR+Y+SRHVVFDENT PF+ L P D T Sbjct: 714 GYNEKYKGYRCLYPPTGRIYISRHVVFDENTHPFESIYSHL-HPQDKT 760 >gb|AAK51235.1|AF287471_1 polyprotein [Arabidopsis thaliana] Length = 1453 Score = 58.5 bits (140), Expect = 5e-07 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = -3 Query: 228 G*SEKHKGYRSLYLPTGRVYVSRHVVFDENTFPFQK 121 G + ++KGYR LY PTGRVY+SRHV+FDE TFPF++ Sbjct: 712 GYNSQYKGYRCLYPPTGRVYISRHVIFDEETFPFKQ 747 >emb|CAA19714.1| putative protein [Arabidopsis thaliana] gi|7269573|emb|CAB79575.1| putative protein [Arabidopsis thaliana] Length = 819 Score = 57.4 bits (137), Expect = 1e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -3 Query: 228 G*SEKHKGYRSLYLPTGRVYVSRHVVFDENTFPF 127 G +EK+KGYR LY PTGR+Y+SRHV+FDE+ +PF Sbjct: 41 GYNEKYKGYRCLYPPTGRLYISRHVIFDESVYPF 74 >gb|AAC61290.1| putative retroelement pol polyprotein [Arabidopsis thaliana] Length = 1149 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/59 (47%), Positives = 37/59 (62%) Frame = -3 Query: 228 G*SEKHKGYRSLYLPTGRVYVSRHVVFDENTFPFQKSSPPLSQPMDNTTFTD*V*SIPS 52 G +EK+KGYR + PT RVY+SRHV+FDE++FPF + L P F + S PS Sbjct: 702 GYTEKYKGYRCFFPPTNRVYLSRHVLFDESSFPFIDTYTSLQHPSPTPMFDAWLKSFPS 760 >emb|CAA19715.1| putative protein [Arabidopsis thaliana] gi|7269574|emb|CAB79576.1| putative protein [Arabidopsis thaliana] Length = 1318 Score = 57.4 bits (137), Expect = 1e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -3 Query: 228 G*SEKHKGYRSLYLPTGRVYVSRHVVFDENTFPF 127 G +EK+KGYR LY PTGR+Y+SRHV+FDE+ +PF Sbjct: 525 GYNEKYKGYRCLYPPTGRLYISRHVIFDESVYPF 558