BLASTX nr result
ID: Cimicifuga21_contig00033617
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00033617 (260 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI28140.3| unnamed protein product [Vitis vinifera] 92 6e-17 ref|XP_002281711.1| PREDICTED: pentatricopeptide repeat-containi... 92 6e-17 ref|XP_002271484.1| PREDICTED: pentatricopeptide repeat-containi... 90 2e-16 emb|CAN72195.1| hypothetical protein VITISV_014979 [Vitis vinifera] 90 2e-16 tpg|DAA57875.1| TPA: hypothetical protein ZEAMMB73_657034, parti... 90 2e-16 >emb|CBI28140.3| unnamed protein product [Vitis vinifera] Length = 580 Score = 91.7 bits (226), Expect = 6e-17 Identities = 34/48 (70%), Positives = 45/48 (93%) Frame = -3 Query: 258 VMKNLRICTDCHRFMKFVSKVYNKEIVIRDRNRFHHFNEGSCSCKDYW 115 V+KNLR+C+DCH MKF+S+VYN+EI++RDRNRFHHF +GSCSC+D+W Sbjct: 533 VVKNLRVCSDCHSAMKFISEVYNREIIVRDRNRFHHFTKGSCSCRDFW 580 >ref|XP_002281711.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic [Vitis vinifera] Length = 711 Score = 91.7 bits (226), Expect = 6e-17 Identities = 34/48 (70%), Positives = 45/48 (93%) Frame = -3 Query: 258 VMKNLRICTDCHRFMKFVSKVYNKEIVIRDRNRFHHFNEGSCSCKDYW 115 V+KNLR+C+DCH MKF+S+VYN+EI++RDRNRFHHF +GSCSC+D+W Sbjct: 664 VVKNLRVCSDCHSAMKFISEVYNREIIVRDRNRFHHFTKGSCSCRDFW 711 >ref|XP_002271484.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Vitis vinifera] Length = 558 Score = 90.1 bits (222), Expect = 2e-16 Identities = 36/48 (75%), Positives = 43/48 (89%) Frame = -3 Query: 258 VMKNLRICTDCHRFMKFVSKVYNKEIVIRDRNRFHHFNEGSCSCKDYW 115 VMKNLRIC DCH FMK+ S V+ +EI+IRDRNRFHHF++GSCSC+DYW Sbjct: 511 VMKNLRICHDCHCFMKYASDVFEREIIIRDRNRFHHFSKGSCSCRDYW 558 >emb|CAN72195.1| hypothetical protein VITISV_014979 [Vitis vinifera] Length = 558 Score = 90.1 bits (222), Expect = 2e-16 Identities = 36/48 (75%), Positives = 43/48 (89%) Frame = -3 Query: 258 VMKNLRICTDCHRFMKFVSKVYNKEIVIRDRNRFHHFNEGSCSCKDYW 115 VMKNLRIC DCH FMK+ S V+ +EI+IRDRNRFHHF++GSCSC+DYW Sbjct: 511 VMKNLRICHDCHCFMKYASDVFEREIIIRDRNRFHHFSKGSCSCRDYW 558 >tpg|DAA57875.1| TPA: hypothetical protein ZEAMMB73_657034, partial [Zea mays] Length = 1822 Score = 89.7 bits (221), Expect = 2e-16 Identities = 34/48 (70%), Positives = 43/48 (89%) Frame = -3 Query: 258 VMKNLRICTDCHRFMKFVSKVYNKEIVIRDRNRFHHFNEGSCSCKDYW 115 ++KNLR+C DCHR++K VSKV+N+EIV+RDRNRFHHF G CSC+DYW Sbjct: 1775 IVKNLRVCMDCHRYIKLVSKVFNREIVMRDRNRFHHFKGGECSCRDYW 1822