BLASTX nr result
ID: Cimicifuga21_contig00033542
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00033542 (274 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003528534.1| PREDICTED: LOW QUALITY PROTEIN: peptide tran... 59 3e-07 ref|XP_003524136.1| PREDICTED: peptide transporter PTR2-like [Gl... 59 5e-07 emb|CBI26754.3| unnamed protein product [Vitis vinifera] 59 5e-07 ref|XP_002285274.1| PREDICTED: peptide transporter PTR2-like [Vi... 59 5e-07 emb|CAN80199.1| hypothetical protein VITISV_030909 [Vitis vinifera] 59 5e-07 >ref|XP_003528534.1| PREDICTED: LOW QUALITY PROTEIN: peptide transporter PTR2-like [Glycine max] Length = 391 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/39 (64%), Positives = 33/39 (84%) Frame = +2 Query: 56 RCLDKVAVITYLELKSENYSNPWNLCKVTQVEKLEILIC 172 RCLD+VA+++ E KS +YSNPW LC +TQVE+L+ILIC Sbjct: 123 RCLDRVAIVSDYESKSGDYSNPWRLCTMTQVEELKILIC 161 >ref|XP_003524136.1| PREDICTED: peptide transporter PTR2-like [Glycine max] Length = 703 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = +2 Query: 56 RCLDKVAVITYLELKSENYSNPWNLCKVTQVEKLEILIC 172 RCLD+ A+++ E KS +YSNPW LC VTQVE+L+ILIC Sbjct: 430 RCLDRAAIVSDSESKSGDYSNPWKLCTVTQVEELKILIC 468 >emb|CBI26754.3| unnamed protein product [Vitis vinifera] Length = 482 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = +2 Query: 56 RCLDKVAVITYLELKSENYSNPWNLCKVTQVEKLEILI 169 +CLDK AVI+ E+KS ++SNPWNLC VTQVE+L+ILI Sbjct: 313 KCLDKAAVISDAEIKSGDFSNPWNLCTVTQVEELKILI 350 >ref|XP_002285274.1| PREDICTED: peptide transporter PTR2-like [Vitis vinifera] Length = 586 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = +2 Query: 56 RCLDKVAVITYLELKSENYSNPWNLCKVTQVEKLEILI 169 +CLDK AVI+ E+KS ++SNPWNLC VTQVE+L+ILI Sbjct: 313 KCLDKAAVISDAEIKSGDFSNPWNLCTVTQVEELKILI 350 >emb|CAN80199.1| hypothetical protein VITISV_030909 [Vitis vinifera] Length = 551 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = +2 Query: 56 RCLDKVAVITYLELKSENYSNPWNLCKVTQVEKLEILI 169 +CLDK AVI+ E+KS ++SNPWNLC VTQVE+L+ILI Sbjct: 313 KCLDKAAVISDAEIKSGDFSNPWNLCTVTQVEELKILI 350