BLASTX nr result
ID: Cimicifuga21_contig00033524
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00033524 (383 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004166269.1| PREDICTED: respiratory burst oxidase homolog... 160 1e-37 ref|XP_004143967.1| PREDICTED: respiratory burst oxidase homolog... 160 1e-37 gb|ACF05505.1| RBOHD [Citrullus colocynthis] 160 1e-37 gb|AAB87790.1| RbohAOsp [Oryza sativa] 157 6e-37 gb|AAD25225.1|AF088279_1 NADPH oxidase [Potamogeton crispus] 157 1e-36 >ref|XP_004166269.1| PREDICTED: respiratory burst oxidase homolog protein A-like [Cucumis sativus] Length = 935 Score = 160 bits (405), Expect = 1e-37 Identities = 76/82 (92%), Positives = 78/82 (95%) Frame = +3 Query: 138 HPFSITSSPGDDYLSIHIRQLGDWT*ELKRVFAEACEPPSGGKSGLLRADETTKKSLPKL 317 HPFSITS+PGDDYLS+HIRQLGDWT ELKRVFAEACEPP GKSGLLRADETTKK LPKL Sbjct: 656 HPFSITSAPGDDYLSVHIRQLGDWTQELKRVFAEACEPPVAGKSGLLRADETTKKCLPKL 715 Query: 318 LIDGPYGAPAQDYRNYDVLLLV 383 LIDGPYGAPAQDYRNYDVLLLV Sbjct: 716 LIDGPYGAPAQDYRNYDVLLLV 737 >ref|XP_004143967.1| PREDICTED: respiratory burst oxidase homolog protein A-like [Cucumis sativus] Length = 927 Score = 160 bits (405), Expect = 1e-37 Identities = 76/82 (92%), Positives = 78/82 (95%) Frame = +3 Query: 138 HPFSITSSPGDDYLSIHIRQLGDWT*ELKRVFAEACEPPSGGKSGLLRADETTKKSLPKL 317 HPFSITS+PGDDYLS+HIRQLGDWT ELKRVFAEACEPP GKSGLLRADETTKK LPKL Sbjct: 656 HPFSITSAPGDDYLSVHIRQLGDWTQELKRVFAEACEPPVAGKSGLLRADETTKKCLPKL 715 Query: 318 LIDGPYGAPAQDYRNYDVLLLV 383 LIDGPYGAPAQDYRNYDVLLLV Sbjct: 716 LIDGPYGAPAQDYRNYDVLLLV 737 >gb|ACF05505.1| RBOHD [Citrullus colocynthis] Length = 315 Score = 160 bits (405), Expect = 1e-37 Identities = 76/82 (92%), Positives = 78/82 (95%) Frame = +3 Query: 138 HPFSITSSPGDDYLSIHIRQLGDWT*ELKRVFAEACEPPSGGKSGLLRADETTKKSLPKL 317 HPFSITS+PGDDYLS+HIRQLGDWT ELKRVFAEACEPP GKSGLLRADETTKK LPKL Sbjct: 229 HPFSITSAPGDDYLSVHIRQLGDWTRELKRVFAEACEPPVAGKSGLLRADETTKKCLPKL 288 Query: 318 LIDGPYGAPAQDYRNYDVLLLV 383 LIDGPYGAPAQDYRNYDVLLLV Sbjct: 289 LIDGPYGAPAQDYRNYDVLLLV 310 >gb|AAB87790.1| RbohAOsp [Oryza sativa] Length = 745 Score = 157 bits (398), Expect = 6e-37 Identities = 74/82 (90%), Positives = 78/82 (95%) Frame = +3 Query: 138 HPFSITSSPGDDYLSIHIRQLGDWT*ELKRVFAEACEPPSGGKSGLLRADETTKKSLPKL 317 HPFSITS+PGDDYLSIH+RQLGDWT ELKRVFA ACEPP+GGKSGLLRADETTKKSLPKL Sbjct: 466 HPFSITSAPGDDYLSIHVRQLGDWTRELKRVFAAACEPPAGGKSGLLRADETTKKSLPKL 525 Query: 318 LIDGPYGAPAQDYRNYDVLLLV 383 LIDGPYG+PAQDY YDVLLLV Sbjct: 526 LIDGPYGSPAQDYSKYDVLLLV 547 >gb|AAD25225.1|AF088279_1 NADPH oxidase [Potamogeton crispus] Length = 180 Score = 157 bits (396), Expect = 1e-36 Identities = 74/86 (86%), Positives = 79/86 (91%) Frame = +3 Query: 126 SYSRHPFSITSSPGDDYLSIHIRQLGDWT*ELKRVFAEACEPPSGGKSGLLRADETTKKS 305 S+ HPFSITS+PGDDYLSIHIRQLGDWT ELKRVF EACEPP G+SGLLRADETTKKS Sbjct: 11 SFEWHPFSITSAPGDDYLSIHIRQLGDWTRELKRVFTEACEPPVTGRSGLLRADETTKKS 70 Query: 306 LPKLLIDGPYGAPAQDYRNYDVLLLV 383 +PKL+IDGPYGAPAQDYR YDVLLLV Sbjct: 71 MPKLMIDGPYGAPAQDYRKYDVLLLV 96