BLASTX nr result
ID: Cimicifuga21_contig00033319
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00033319 (232 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003602276.1| Protein ABIL2 [Medicago truncatula] gi|35549... 57 1e-06 ref|NP_197819.2| protein ABIL3 [Arabidopsis thaliana] gi|7512703... 57 2e-06 dbj|BAB10397.1| unnamed protein product [Arabidopsis thaliana] 57 2e-06 ref|XP_002872104.1| hypothetical protein ARALYDRAFT_489290 [Arab... 57 2e-06 ref|XP_003588502.1| Protein ABIL3 [Medicago truncatula] gi|35547... 56 3e-06 >ref|XP_003602276.1| Protein ABIL2 [Medicago truncatula] gi|355491324|gb|AES72527.1| Protein ABIL2 [Medicago truncatula] Length = 326 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 230 PSKSKRIFKALLSRRKAKQDDTLYTYLDEY 141 PSKSKR+ KALLSRRK+K+DDTLYTYLDEY Sbjct: 297 PSKSKRLLKALLSRRKSKKDDTLYTYLDEY 326 >ref|NP_197819.2| protein ABIL3 [Arabidopsis thaliana] gi|75127037|sp|Q6NMC6.1|ABIL3_ARATH RecName: Full=Protein ABIL3; AltName: Full=Abl interactor-like protein 3; Short=AtABIL3 gi|44917545|gb|AAS49097.1| At5g24310 [Arabidopsis thaliana] gi|57240096|gb|AAW49258.1| Abl interactor-like protein-3 [Arabidopsis thaliana] gi|62321758|dbj|BAD95383.1| hypothetical protein [Arabidopsis thaliana] gi|110737536|dbj|BAF00710.1| hypothetical protein [Arabidopsis thaliana] gi|332005902|gb|AED93285.1| protein ABIL3 [Arabidopsis thaliana] Length = 321 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 230 PSKSKRIFKALLSRRKAKQDDTLYTYLDEY 141 PSKSKR+ KALLSRRK K+DDTLYTYLDEY Sbjct: 292 PSKSKRLLKALLSRRKTKKDDTLYTYLDEY 321 >dbj|BAB10397.1| unnamed protein product [Arabidopsis thaliana] Length = 333 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 230 PSKSKRIFKALLSRRKAKQDDTLYTYLDEY 141 PSKSKR+ KALLSRRK K+DDTLYTYLDEY Sbjct: 304 PSKSKRLLKALLSRRKTKKDDTLYTYLDEY 333 >ref|XP_002872104.1| hypothetical protein ARALYDRAFT_489290 [Arabidopsis lyrata subsp. lyrata] gi|297317941|gb|EFH48363.1| hypothetical protein ARALYDRAFT_489290 [Arabidopsis lyrata subsp. lyrata] Length = 321 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 230 PSKSKRIFKALLSRRKAKQDDTLYTYLDEY 141 PSKSKR+ KALLSRRK K+DDTLYTYLDEY Sbjct: 292 PSKSKRLLKALLSRRKTKKDDTLYTYLDEY 321 >ref|XP_003588502.1| Protein ABIL3 [Medicago truncatula] gi|355477550|gb|AES58753.1| Protein ABIL3 [Medicago truncatula] Length = 323 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 230 PSKSKRIFKALLSRRKAKQDDTLYTYLDEY 141 PSKSKR+ K+LLSRRK+K+DDTLYTYLDEY Sbjct: 294 PSKSKRLLKSLLSRRKSKKDDTLYTYLDEY 323