BLASTX nr result
ID: Cimicifuga21_contig00033196
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00033196 (370 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522229.1| conserved hypothetical protein [Ricinus comm... 82 5e-14 emb|CBI30704.3| unnamed protein product [Vitis vinifera] 80 1e-13 ref|XP_002265875.2| PREDICTED: DUF246 domain-containing protein ... 79 3e-13 ref|XP_003547176.1| PREDICTED: DUF246 domain-containing protein ... 75 7e-12 ref|XP_003541696.1| PREDICTED: DUF246 domain-containing protein ... 72 5e-11 >ref|XP_002522229.1| conserved hypothetical protein [Ricinus communis] gi|223538482|gb|EEF40087.1| conserved hypothetical protein [Ricinus communis] Length = 598 Score = 82.0 bits (201), Expect = 5e-14 Identities = 42/77 (54%), Positives = 51/77 (66%) Frame = -1 Query: 271 IKIKVGNGLV*SSCSDGFRKDEMSGLTDEQKTPVVLYGRLLNLASSALAEKEFKHHSSTP 92 I ++VG+ SS K+E E+K PV +Y RLLNLASSALAEKEFK S Sbjct: 109 INVQVGS----SSRKSSRFKEERIAYNSEEKPPVQMYSRLLNLASSALAEKEFKREKSNF 164 Query: 91 WEEPYKQASAWKPCADQ 41 WEEPY++AS WKPCAD+ Sbjct: 165 WEEPYQKASVWKPCADK 181 >emb|CBI30704.3| unnamed protein product [Vitis vinifera] Length = 629 Score = 80.5 bits (197), Expect = 1e-13 Identities = 38/63 (60%), Positives = 48/63 (76%) Frame = -1 Query: 229 SDGFRKDEMSGLTDEQKTPVVLYGRLLNLASSALAEKEFKHHSSTPWEEPYKQASAWKPC 50 S G ++D+ +E+K+PV++Y RLLNLASSALAEKEFK S WEEPY+ AS WKPC Sbjct: 125 SSGLKEDK--SYPNEEKSPVLMYDRLLNLASSALAEKEFKQDSLNFWEEPYRHASVWKPC 182 Query: 49 ADQ 41 AD+ Sbjct: 183 ADR 185 >ref|XP_002265875.2| PREDICTED: DUF246 domain-containing protein At1g04910-like [Vitis vinifera] Length = 628 Score = 79.3 bits (194), Expect = 3e-13 Identities = 39/59 (66%), Positives = 45/59 (76%), Gaps = 5/59 (8%) Frame = -1 Query: 202 SGLTD-----EQKTPVVLYGRLLNLASSALAEKEFKHHSSTPWEEPYKQASAWKPCADQ 41 SGL D E+K+PV++Y RLLNLASSALAEKEFK S WEEPY+ AS WKPCAD+ Sbjct: 126 SGLKDKSYPNEEKSPVLMYDRLLNLASSALAEKEFKQDSLNFWEEPYRHASVWKPCADR 184 >ref|XP_003547176.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Glycine max] Length = 583 Score = 74.7 bits (182), Expect = 7e-12 Identities = 35/60 (58%), Positives = 44/60 (73%) Frame = -1 Query: 184 QKTPVVLYGRLLNLASSALAEKEFKHHSSTPWEEPYKQASAWKPCADQHNLLPEDKPTKN 5 +++PV +Y RLLNLASSALAEKEFK SS W EP++QAS WKPCA++ KP +N Sbjct: 95 KQSPVYMYERLLNLASSALAEKEFKQESSNLWVEPFRQASLWKPCAERKVQTNPRKPVQN 154 >ref|XP_003541696.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Glycine max] Length = 583 Score = 72.0 bits (175), Expect = 5e-11 Identities = 33/60 (55%), Positives = 43/60 (71%) Frame = -1 Query: 184 QKTPVVLYGRLLNLASSALAEKEFKHHSSTPWEEPYKQASAWKPCADQHNLLPEDKPTKN 5 +++PV +Y RLLNLASSALAEKEFK SS W E ++QAS WKPC+++ KP +N Sbjct: 95 KRSPVYMYERLLNLASSALAEKEFKQESSNLWVETFRQASLWKPCSERKTQTNPRKPVQN 154