BLASTX nr result
ID: Cimicifuga21_contig00033143
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00033143 (338 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517005.1| conserved hypothetical protein [Ricinus comm... 74 2e-11 ref|XP_003590109.1| hypothetical protein MTR_1g044470 [Medicago ... 57 2e-06 >ref|XP_002517005.1| conserved hypothetical protein [Ricinus communis] gi|223543640|gb|EEF45168.1| conserved hypothetical protein [Ricinus communis] Length = 103 Score = 73.6 bits (179), Expect = 2e-11 Identities = 39/90 (43%), Positives = 51/90 (56%), Gaps = 2/90 (2%) Frame = +3 Query: 24 AMIVLVLTVHPYNATRILYDQEQYTSTKRSLVAESLQRGPVTPSGPSGCSYIPGNGRPSC 203 A+++L V Y A+RILYDQ+ + L +SLQRG +G SGC+ IP G PSC Sbjct: 11 ALLLLSFHVQQYQASRILYDQD----VNKELGVQSLQRGDTPSTGASGCTNIPNTGGPSC 66 Query: 204 P--INGKKVVGNAFNRGRAFPHLLMPFGVA 287 P IN V GN + A+P L + FG A Sbjct: 67 PSVINSMNVAGNGLSHASAYPRLTVEFGAA 96 >ref|XP_003590109.1| hypothetical protein MTR_1g044470 [Medicago truncatula] gi|355479157|gb|AES60360.1| hypothetical protein MTR_1g044470 [Medicago truncatula] Length = 83 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/73 (36%), Positives = 43/73 (58%) Frame = +3 Query: 15 MVLAMIVLVLTVHPYNATRILYDQEQYTSTKRSLVAESLQRGPVTPSGPSGCSYIPGNGR 194 +V +++ ++ V P R+L +E L ++L +GPV PSGPSGC++IPG+G Sbjct: 9 LVFLLLLTIIHVRPNLGVRVLNMKE--------LRLQALDKGPVAPSGPSGCTFIPGSGG 60 Query: 195 PSCPINGKKVVGN 233 CPI + V G+ Sbjct: 61 THCPIEERNVAGH 73