BLASTX nr result
ID: Cimicifuga21_contig00032880
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00032880 (380 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511355.1| ubiquitin-protein ligase, putative [Ricinus ... 58 9e-07 gb|ACZ74683.1| cyclin-like F-box [Phaseolus vulgaris] 56 3e-06 gb|ACZ74682.1| cyclin-like F-box [Phaseolus vulgaris] 55 5e-06 >ref|XP_002511355.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223550470|gb|EEF51957.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 457 Score = 57.8 bits (138), Expect = 9e-07 Identities = 31/51 (60%), Positives = 36/51 (70%) Frame = -2 Query: 232 KDRISELPGEILCSILSLLTMKEAARTSTLSRRWSCMWKTSVESSSSLNLD 80 +DRIS LP EIL SILS LT +EA+RTS LSRRW +W +SSLN D Sbjct: 18 EDRISHLPEEILTSILSFLTTEEASRTSVLSRRWRILWTL----TSSLNFD 64 >gb|ACZ74683.1| cyclin-like F-box [Phaseolus vulgaris] Length = 384 Score = 56.2 bits (134), Expect = 3e-06 Identities = 28/63 (44%), Positives = 39/63 (61%) Frame = -2 Query: 229 DRISELPGEILCSILSLLTMKEAARTSTLSRRWSCMWKTSVESSSSLNLDILAMRGSEYS 50 DRIS P ILC++LS L+ KEA TS LS+RW+ +W+ S +LD + G+EY Sbjct: 29 DRISNFPHSILCNVLSFLSTKEAVATSVLSKRWNLLWR------SVPSLDFVHPGGAEYV 82 Query: 49 DSI 41 D + Sbjct: 83 DEV 85 >gb|ACZ74682.1| cyclin-like F-box [Phaseolus vulgaris] Length = 378 Score = 55.5 bits (132), Expect = 5e-06 Identities = 28/65 (43%), Positives = 38/65 (58%) Frame = -2 Query: 235 LKDRISELPGEILCSILSLLTMKEAARTSTLSRRWSCMWKTSVESSSSLNLDILAMRGSE 56 + DRIS P ILC +LS L+ KEA TS LS+RW+ +W+ S +LD + G E Sbjct: 1 MPDRISNFPDSILCYVLSFLSTKEAVATSVLSKRWNLLWR------SVPSLDFVYPGGDE 54 Query: 55 YSDSI 41 Y D + Sbjct: 55 YVDEV 59