BLASTX nr result
ID: Cimicifuga21_contig00032774
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00032774 (475 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276142.2| PREDICTED: pentatricopeptide repeat-containi... 75 7e-12 ref|XP_002876469.1| pentatricopeptide repeat-containing protein ... 62 4e-08 ref|XP_002525134.1| pentatricopeptide repeat-containing protein,... 62 6e-08 ref|NP_191418.2| pentatricopeptide repeat-containing protein [Ar... 61 1e-07 emb|CAB68197.1| putative protein [Arabidopsis thaliana] 61 1e-07 >ref|XP_002276142.2| PREDICTED: pentatricopeptide repeat-containing protein At3g58590-like [Vitis vinifera] Length = 921 Score = 74.7 bits (182), Expect = 7e-12 Identities = 43/81 (53%), Positives = 55/81 (67%), Gaps = 7/81 (8%) Frame = +3 Query: 252 YPSMALESFREMKSLGIKLD--LL*A*TS-----WMIDEGMELFGRKKESCNIEPEMDHY 410 Y + AL+ FREM+SLG K D L A S ++ EGMELF + K+SC IEP +DHY Sbjct: 665 YANEALKLFREMESLGFKPDGVALVAVFSACRHGGLVKEGMELFWQMKKSCGIEPNIDHY 724 Query: 411 ICVVDLLNRFGHRKEAEELVS 473 CVVDLL R GH +EAE+++S Sbjct: 725 HCVVDLLARCGHLQEAEQVIS 745 >ref|XP_002876469.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297322307|gb|EFH52728.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 741 Score = 62.4 bits (150), Expect = 4e-08 Identities = 39/80 (48%), Positives = 46/80 (57%), Gaps = 7/80 (8%) Frame = +3 Query: 252 YPSMALESFREMKSLGIKLD-------LL*A*TSWMIDEGMELFGRKKESCNIEPEMDHY 410 Y ALE F+E SLG K D L M+ EGM+LF + K+ IEPEMDHY Sbjct: 627 YGHEALEKFKETLSLGFKPDRVSFISILTACRHGGMVKEGMDLFQKMKDY-GIEPEMDHY 685 Query: 411 ICVVDLLNRFGHRKEAEELV 470 C VDLL R G+ KEAE L+ Sbjct: 686 RCAVDLLARNGYLKEAEHLI 705 >ref|XP_002525134.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223535593|gb|EEF37261.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 792 Score = 61.6 bits (148), Expect = 6e-08 Identities = 34/77 (44%), Positives = 50/77 (64%), Gaps = 7/77 (9%) Frame = +3 Query: 264 ALESFREMKSLGIKLD-------LL*A*TSWMIDEGMELFGRKKESCNIEPEMDHYICVV 422 ALE F++M+ G++ D L ++ EG+ELF +K +S +EPEMDHY C+V Sbjct: 631 ALERFKDMEHQGLRPDKVAFIAVLTACRHGALVGEGIELF-KKMKSYGLEPEMDHYHCLV 689 Query: 423 DLLNRFGHRKEAEELVS 473 DL +R GH KEAE+++S Sbjct: 690 DLFSRHGHVKEAEKVIS 706 >ref|NP_191418.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|218525906|sp|Q0WN01.2|PP286_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g58590 gi|332646281|gb|AEE79802.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 741 Score = 60.8 bits (146), Expect = 1e-07 Identities = 38/80 (47%), Positives = 45/80 (56%), Gaps = 7/80 (8%) Frame = +3 Query: 252 YPSMALESFREMKSLGIKLD-------LL*A*TSWMIDEGMELFGRKKESCNIEPEMDHY 410 Y ALE F+E SLG K D L M+ EGM LF + K+ +EPEMDHY Sbjct: 627 YGQEALEKFKETLSLGFKPDRVSFISILTACRHGGMVKEGMGLFQKMKDY-GVEPEMDHY 685 Query: 411 ICVVDLLNRFGHRKEAEELV 470 C VDLL R G+ KEAE L+ Sbjct: 686 RCAVDLLARNGYLKEAEHLI 705 >emb|CAB68197.1| putative protein [Arabidopsis thaliana] Length = 810 Score = 60.8 bits (146), Expect = 1e-07 Identities = 38/80 (47%), Positives = 45/80 (56%), Gaps = 7/80 (8%) Frame = +3 Query: 252 YPSMALESFREMKSLGIKLD-------LL*A*TSWMIDEGMELFGRKKESCNIEPEMDHY 410 Y ALE F+E SLG K D L M+ EGM LF + K+ +EPEMDHY Sbjct: 696 YGQEALEKFKETLSLGFKPDRVSFISILTACRHGGMVKEGMGLFQKMKDY-GVEPEMDHY 754 Query: 411 ICVVDLLNRFGHRKEAEELV 470 C VDLL R G+ KEAE L+ Sbjct: 755 RCAVDLLARNGYLKEAEHLI 774