BLASTX nr result
ID: Cimicifuga21_contig00032704
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00032704 (352 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002264031.1| PREDICTED: probable beta-D-xylosidase 6-like... 95 5e-18 emb|CBI25718.3| unnamed protein product [Vitis vinifera] 95 5e-18 ref|XP_002299457.1| predicted protein [Populus trichocarpa] gi|2... 94 9e-18 ref|XP_002527212.1| beta-glucosidase, putative [Ricinus communis... 94 2e-17 gb|AFI25186.1| putative beta-D-xylosidase [Nicotiana tabacum] 89 3e-16 >ref|XP_002264031.1| PREDICTED: probable beta-D-xylosidase 6-like [Vitis vinifera] Length = 789 Score = 95.1 bits (235), Expect = 5e-18 Identities = 45/67 (67%), Positives = 52/67 (77%) Frame = +3 Query: 150 ATHAQYPCKPPNHNSYTFCNTSLPISTRAQSLISLPTLPGKIT*LCNNASPIARLGIPAY 329 +TH Q+PC PP ++ Y FCNTSLPISTRAQSL+SL TL KI L + A+ I RL IPAY Sbjct: 25 STHPQFPCMPPTNSDYPFCNTSLPISTRAQSLVSLLTLSEKIQQLSDEAAAIPRLYIPAY 84 Query: 330 EWWSESL 350 EWWSESL Sbjct: 85 EWWSESL 91 >emb|CBI25718.3| unnamed protein product [Vitis vinifera] Length = 768 Score = 95.1 bits (235), Expect = 5e-18 Identities = 45/67 (67%), Positives = 52/67 (77%) Frame = +3 Query: 150 ATHAQYPCKPPNHNSYTFCNTSLPISTRAQSLISLPTLPGKIT*LCNNASPIARLGIPAY 329 +TH Q+PC PP ++ Y FCNTSLPISTRAQSL+SL TL KI L + A+ I RL IPAY Sbjct: 25 STHPQFPCMPPTNSDYPFCNTSLPISTRAQSLVSLLTLSEKIQQLSDEAAAIPRLYIPAY 84 Query: 330 EWWSESL 350 EWWSESL Sbjct: 85 EWWSESL 91 >ref|XP_002299457.1| predicted protein [Populus trichocarpa] gi|222846715|gb|EEE84262.1| predicted protein [Populus trichocarpa] Length = 780 Score = 94.4 bits (233), Expect = 9e-18 Identities = 45/63 (71%), Positives = 50/63 (79%) Frame = +3 Query: 162 QYPCKPPNHNSYTFCNTSLPISTRAQSLISLPTLPGKIT*LCNNASPIARLGIPAYEWWS 341 Q+PCKPP HN+Y+FCN SLPI+ RAQSLIS TL KI L +NAS I RLGIP YEWWS Sbjct: 29 QFPCKPPTHNTYSFCNKSLPITRRAQSLISHLTLQEKIQQLSDNASGIPRLGIPHYEWWS 88 Query: 342 ESL 350 ESL Sbjct: 89 ESL 91 >ref|XP_002527212.1| beta-glucosidase, putative [Ricinus communis] gi|223533388|gb|EEF35138.1| beta-glucosidase, putative [Ricinus communis] Length = 349 Score = 93.6 bits (231), Expect = 2e-17 Identities = 45/63 (71%), Positives = 48/63 (76%) Frame = +3 Query: 162 QYPCKPPNHNSYTFCNTSLPISTRAQSLISLPTLPGKIT*LCNNASPIARLGIPAYEWWS 341 QYPC+PP HNSYTFCN SL + TRA SLISL TL KI L +NAS I R GIP YEWWS Sbjct: 29 QYPCQPPLHNSYTFCNQSLSVPTRAHSLISLLTLEEKIKQLSDNASGIPRFGIPPYEWWS 88 Query: 342 ESL 350 ESL Sbjct: 89 ESL 91 >gb|AFI25186.1| putative beta-D-xylosidase [Nicotiana tabacum] Length = 791 Score = 89.4 bits (220), Expect = 3e-16 Identities = 42/63 (66%), Positives = 50/63 (79%) Frame = +3 Query: 162 QYPCKPPNHNSYTFCNTSLPISTRAQSLISLPTLPGKIT*LCNNASPIARLGIPAYEWWS 341 Q+PC+PP+H YTFCN +LPISTR QSLISL T+ KI L +N + I RLG+PAYEWWS Sbjct: 31 QFPCQPPHHK-YTFCNKNLPISTRVQSLISLLTIDEKILHLSDNTTSIPRLGLPAYEWWS 89 Query: 342 ESL 350 ESL Sbjct: 90 ESL 92