BLASTX nr result
ID: Cimicifuga21_contig00032614
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00032614 (398 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAZ40333.1| hypothetical protein [Raphanus sativus] 62 6e-08 >emb|CAZ40333.1| hypothetical protein [Raphanus sativus] Length = 785 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/48 (60%), Positives = 39/48 (81%) Frame = +2 Query: 71 PNVCPLKLPSHMRTSDVFNMKHLVPCRGNDDESLNSMANSSQPGGNEA 214 PNV ++LPSH+RTSDVFN+KHL P +G++D+ +S AN SQPGG +A Sbjct: 736 PNVYRVRLPSHLRTSDVFNIKHLSPFKGDNDDP-DSWANPSQPGGPDA 782