BLASTX nr result
ID: Cimicifuga21_contig00032566
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00032566 (352 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002334407.1| predicted protein [Populus trichocarpa] gi|2... 83 2e-14 ref|XP_002515124.1| pentatricopeptide repeat-containing protein,... 76 3e-12 ref|XP_002272556.1| PREDICTED: pentatricopeptide repeat-containi... 76 3e-12 gb|AAC62783.1| F11O4.7 [Arabidopsis thaliana] 75 4e-12 ref|NP_192066.2| pentatricopeptide repeat-containing protein [Ar... 75 4e-12 >ref|XP_002334407.1| predicted protein [Populus trichocarpa] gi|222872045|gb|EEF09176.1| predicted protein [Populus trichocarpa] Length = 513 Score = 83.2 bits (204), Expect = 2e-14 Identities = 39/61 (63%), Positives = 52/61 (85%) Frame = +3 Query: 168 NLLLVASIAKTLIESGPQNLNADSIPISESLVLEILKRHSIPTSKKIGFFKWASLRHNYK 347 N+LLVA + KTL ESG ++L+ DSIP+SESLVL+IL+R+S+ +SKK+ FFKW S+RH YK Sbjct: 3 NILLVAYLTKTLSESGTRSLDPDSIPLSESLVLQILRRNSLDSSKKMEFFKWCSVRHIYK 62 Query: 348 H 350 H Sbjct: 63 H 63 >ref|XP_002515124.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223545604|gb|EEF47108.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 898 Score = 76.3 bits (186), Expect = 3e-12 Identities = 35/62 (56%), Positives = 48/62 (77%) Frame = +3 Query: 165 QNLLLVASIAKTLIESGPQNLNADSIPISESLVLEILKRHSIPTSKKIGFFKWASLRHNY 344 +++LLVA + K L ESG +NL+ D IP+SE L+L+IL+++S+ SKKI FFKW S HNY Sbjct: 50 ESILLVAFLNKALSESGVRNLDPDFIPLSEPLILQILRQNSLDASKKIEFFKWCSFSHNY 109 Query: 345 KH 350 KH Sbjct: 110 KH 111 >ref|XP_002272556.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01570 [Vitis vinifera] Length = 792 Score = 76.3 bits (186), Expect = 3e-12 Identities = 36/61 (59%), Positives = 49/61 (80%) Frame = +3 Query: 168 NLLLVASIAKTLIESGPQNLNADSIPISESLVLEILKRHSIPTSKKIGFFKWASLRHNYK 347 ++LLVASI+KTL E G ++ + +SIPISESLV++IL R+SI +K+ FF+W S RHNYK Sbjct: 21 DMLLVASISKTLSERGTRSPDLESIPISESLVVQILGRNSIDVFRKVEFFRWCSFRHNYK 80 Query: 348 H 350 H Sbjct: 81 H 81 >gb|AAC62783.1| F11O4.7 [Arabidopsis thaliana] Length = 508 Score = 75.5 bits (184), Expect = 4e-12 Identities = 38/62 (61%), Positives = 52/62 (83%), Gaps = 1/62 (1%) Frame = +3 Query: 168 NLLLVASIAKTLIESGPQNLNADSIPISESLVLEILKRHSIPTSKKIGFFKWA-SLRHNY 344 N+LLVAS++KTL +SG ++L+A+SIPISE +VL+IL+R+SI SKK+ FF+W SLR Y Sbjct: 29 NVLLVASLSKTLSQSGTRSLDANSIPISEPVVLQILRRNSIDPSKKLDFFRWCYSLRPGY 88 Query: 345 KH 350 KH Sbjct: 89 KH 90 >ref|NP_192066.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75161629|sp|Q8VZE4.1|PP299_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g01570 gi|18086402|gb|AAL57659.1| AT4g01570/T15B16_21 [Arabidopsis thaliana] gi|24797024|gb|AAN64524.1| At4g01570/T15B16_21 [Arabidopsis thaliana] gi|332656643|gb|AEE82043.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 805 Score = 75.5 bits (184), Expect = 4e-12 Identities = 38/62 (61%), Positives = 52/62 (83%), Gaps = 1/62 (1%) Frame = +3 Query: 168 NLLLVASIAKTLIESGPQNLNADSIPISESLVLEILKRHSIPTSKKIGFFKWA-SLRHNY 344 N+LLVAS++KTL +SG ++L+A+SIPISE +VL+IL+R+SI SKK+ FF+W SLR Y Sbjct: 29 NVLLVASLSKTLSQSGTRSLDANSIPISEPVVLQILRRNSIDPSKKLDFFRWCYSLRPGY 88 Query: 345 KH 350 KH Sbjct: 89 KH 90