BLASTX nr result
ID: Cimicifuga21_contig00032264
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00032264 (346 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACV51811.1| metallothionein type 3 [Typha angustifolia] 97 1e-18 sp|Q96386.1|MT3_CARPA RecName: Full=Metallothionein-like protein... 94 9e-18 ref|XP_002316894.1| predicted protein [Populus trichocarpa] gi|4... 92 3e-17 gb|AAO92264.1| metallothionein-like protein [Arachis hypogaea] 92 6e-17 emb|CAB52585.1| metallothionein-like protein [Elaeis guineensis] 90 2e-16 >gb|ACV51811.1| metallothionein type 3 [Typha angustifolia] Length = 64 Score = 97.1 bits (240), Expect = 1e-18 Identities = 41/56 (73%), Positives = 47/56 (83%) Frame = +2 Query: 2 CADKTQCVKKGNSYGVEIIETGKSSYDAVAEVPAGENDGKCKCGPNCACTDCKCGH 169 CADK+QCVKKGNSYGVEIIET KS +D V EV A +N+G CKCGP+CAC DC CG+ Sbjct: 9 CADKSQCVKKGNSYGVEIIETEKSYHDGVFEVAAAKNEGNCKCGPSCACVDCHCGN 64 >sp|Q96386.1|MT3_CARPA RecName: Full=Metallothionein-like protein type 3; Short=MT-3 gi|1566700|emb|CAA69624.1| metallothionein-like protein [Carica papaya] gi|354464673|gb|AER26532.1| metallothionein-like protein [Carica papaya] Length = 65 Score = 94.4 bits (233), Expect = 9e-18 Identities = 39/56 (69%), Positives = 45/56 (80%) Frame = +2 Query: 2 CADKTQCVKKGNSYGVEIIETGKSSYDAVAEVPAGENDGKCKCGPNCACTDCKCGH 169 CADKTQCVKKG+SY +IIET KS V + PA ENDGKCKCGP+C+CT+C CGH Sbjct: 10 CADKTQCVKKGSSYTADIIETEKSIMTVVMDAPAAENDGKCKCGPSCSCTNCTCGH 65 >ref|XP_002316894.1| predicted protein [Populus trichocarpa] gi|46850189|gb|AAT02526.1| metallothionein 3a [Populus trichocarpa x Populus deltoides] gi|118488217|gb|ABK95928.1| unknown [Populus trichocarpa] gi|118489949|gb|ABK96771.1| unknown [Populus trichocarpa x Populus deltoides] gi|222859959|gb|EEE97506.1| predicted protein [Populus trichocarpa] Length = 66 Score = 92.4 bits (228), Expect = 3e-17 Identities = 41/57 (71%), Positives = 44/57 (77%), Gaps = 1/57 (1%) Frame = +2 Query: 2 CADKTQCVKKGNSYGVEIIETGKSS-YDAVAEVPAGENDGKCKCGPNCACTDCKCGH 169 CADKTQCVKKG+SY +I+ET KS Y V EVPA ENDGKCKCG NC CT C CGH Sbjct: 10 CADKTQCVKKGSSYTADIVETEKSHVYTGVMEVPATENDGKCKCGANCTCTTCTCGH 66 >gb|AAO92264.1| metallothionein-like protein [Arachis hypogaea] Length = 65 Score = 91.7 bits (226), Expect = 6e-17 Identities = 41/57 (71%), Positives = 46/57 (80%), Gaps = 1/57 (1%) Frame = +2 Query: 2 CADKTQCVKKGNSYGVEIIETGKSSYDAVA-EVPAGENDGKCKCGPNCACTDCKCGH 169 CADKTQCVK GN YGV+I+ET K + V EVPAGENDGKCKCG NC+CT+C CGH Sbjct: 10 CADKTQCVK-GNKYGVDIVETEKRMVETVVMEVPAGENDGKCKCGANCSCTNCTCGH 65 >emb|CAB52585.1| metallothionein-like protein [Elaeis guineensis] Length = 65 Score = 90.1 bits (222), Expect = 2e-16 Identities = 38/56 (67%), Positives = 47/56 (83%), Gaps = 1/56 (1%) Frame = +2 Query: 2 CADKTQCVKKGNSYGVEIIETGKSSYDAVAEVP-AGENDGKCKCGPNCACTDCKCG 166 CADK+QCVKKGNSYG+EIIET KS+++ V + P A E++G CKCG +CAC DCKCG Sbjct: 9 CADKSQCVKKGNSYGIEIIETEKSNFNNVIDAPAAAEHEGNCKCGASCACVDCKCG 64