BLASTX nr result
ID: Cimicifuga21_contig00032227
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00032227 (220 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAJ29315.1| dof zinc finger protein 10 [Hordeum vulgare subs... 66 3e-09 gb|AEN25822.1| Dof [Sorghum bicolor] 64 1e-08 ref|XP_002439872.1| hypothetical protein SORBIDRAFT_09g021690 [S... 64 1e-08 ref|XP_002262622.1| PREDICTED: dof zinc finger protein DOF3.5-li... 63 2e-08 ref|XP_002524061.1| zinc finger protein, putative [Ricinus commu... 63 2e-08 >emb|CAJ29315.1| dof zinc finger protein 10 [Hordeum vulgare subsp. vulgare] Length = 311 Score = 65.9 bits (159), Expect = 3e-09 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +3 Query: 3 RRYWTKGGSLRNVPFGGGCRKNRRGKPVR 89 RRYWTKGGSLRNVP GGGCRKNRRGKPVR Sbjct: 68 RRYWTKGGSLRNVPVGGGCRKNRRGKPVR 96 >gb|AEN25822.1| Dof [Sorghum bicolor] Length = 104 Score = 63.9 bits (154), Expect = 1e-08 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 3 RRYWTKGGSLRNVPFGGGCRKNRRGKPV 86 RRYWTKGGSLRNVP GGGCRKNRRGKPV Sbjct: 77 RRYWTKGGSLRNVPVGGGCRKNRRGKPV 104 >ref|XP_002439872.1| hypothetical protein SORBIDRAFT_09g021690 [Sorghum bicolor] gi|241945157|gb|EES18302.1| hypothetical protein SORBIDRAFT_09g021690 [Sorghum bicolor] gi|316658155|tpg|DAA34028.1| TPA_inf: Dof-type zinc finger protein 25 [Sorghum bicolor] Length = 366 Score = 63.9 bits (154), Expect = 1e-08 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 3 RRYWTKGGSLRNVPFGGGCRKNRRGKPV 86 RRYWTKGGSLRNVP GGGCRKNRRGKPV Sbjct: 98 RRYWTKGGSLRNVPVGGGCRKNRRGKPV 125 >ref|XP_002262622.1| PREDICTED: dof zinc finger protein DOF3.5-like [Vitis vinifera] Length = 281 Score = 63.2 bits (152), Expect = 2e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 3 RRYWTKGGSLRNVPFGGGCRKNRRGKPVRL 92 RRYWTKGGSLRNVP GGGCRKNRRGK VR+ Sbjct: 63 RRYWTKGGSLRNVPVGGGCRKNRRGKAVRV 92 >ref|XP_002524061.1| zinc finger protein, putative [Ricinus communis] gi|223536629|gb|EEF38271.1| zinc finger protein, putative [Ricinus communis] Length = 308 Score = 63.2 bits (152), Expect = 2e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 3 RRYWTKGGSLRNVPFGGGCRKNRRGKPVRL 92 RRYWTKGGSLRNVP GGGCRKNRRGK +RL Sbjct: 44 RRYWTKGGSLRNVPVGGGCRKNRRGKSLRL 73