BLASTX nr result
ID: Cimicifuga21_contig00032178
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00032178 (301 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAP45174.1| Putative disease resistance protein RGA4, identic... 59 3e-07 sp|Q7XA39.1|RGA4_SOLBU RecName: Full=Putative disease resistance... 59 3e-07 ref|XP_003547542.1| PREDICTED: putative disease resistance prote... 59 3e-07 gb|AAR29072.1| blight resistance protein RGA4 [Solanum bulbocast... 59 3e-07 ref|XP_002302929.1| nbs-lrr resistance protein [Populus trichoca... 59 4e-07 >gb|AAP45174.1| Putative disease resistance protein RGA4, identical [Solanum bulbocastanum] Length = 988 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = +1 Query: 1 LQHLTSLQTLEIVGCHPDLQRRCEKESGEDWHQIAHIPRL 120 LQHLT+L L + GC P++++RC+KE GEDWH+IAHIP L Sbjct: 947 LQHLTALTNLGVSGC-PEVEKRCDKEIGEDWHKIAHIPNL 985 >sp|Q7XA39.1|RGA4_SOLBU RecName: Full=Putative disease resistance protein RGA4; AltName: Full=RGA4-blb gi|32679546|gb|AAP45166.1| Putative disease resistance protein RGA4, identical [Solanum bulbocastanum] Length = 988 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = +1 Query: 1 LQHLTSLQTLEIVGCHPDLQRRCEKESGEDWHQIAHIPRL 120 LQHLT+L L + GC P++++RC+KE GEDWH+IAHIP L Sbjct: 947 LQHLTALTNLGVSGC-PEVEKRCDKEIGEDWHKIAHIPNL 985 >ref|XP_003547542.1| PREDICTED: putative disease resistance protein RGA3-like [Glycine max] Length = 982 Score = 59.3 bits (142), Expect = 3e-07 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = +1 Query: 10 LTSLQTLEIVGCHPDLQRRCEKESGEDWHQIAHIPRL 120 LT+LQ L I GCHP L++RCEKE+G+DW IAHIP + Sbjct: 934 LTNLQQLTIFGCHPKLEKRCEKETGDDWLNIAHIPHI 970 >gb|AAR29072.1| blight resistance protein RGA4 [Solanum bulbocastanum] Length = 1040 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = +1 Query: 1 LQHLTSLQTLEIVGCHPDLQRRCEKESGEDWHQIAHIPRL 120 LQHLT+L L + GC P++++RC+KE GEDWH+IAHIP L Sbjct: 999 LQHLTALTNLGVSGC-PEVEKRCDKEIGEDWHKIAHIPNL 1037 >ref|XP_002302929.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222844655|gb|EEE82202.1| nbs-lrr resistance protein [Populus trichocarpa] Length = 1063 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/40 (65%), Positives = 35/40 (87%) Frame = +1 Query: 1 LQHLTSLQTLEIVGCHPDLQRRCEKESGEDWHQIAHIPRL 120 +QHLTSLQ+L IVGC P+L++RCEK+ GEDW +IAHI ++ Sbjct: 1022 IQHLTSLQSLSIVGC-PNLKKRCEKDLGEDWPKIAHIRKI 1060