BLASTX nr result
ID: Cimicifuga21_contig00032036
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00032036 (213 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_200047.3| exocyst subunit exo70-A2 [Arabidopsis thaliana]... 61 1e-07 dbj|BAB10531.1| unnamed protein product [Arabidopsis thaliana] 61 1e-07 ref|XP_002864165.1| predicted protein [Arabidopsis lyrata subsp.... 59 3e-07 ref|XP_003632655.1| PREDICTED: exocyst complex component 7 isofo... 58 7e-07 ref|XP_003543669.1| PREDICTED: exocyst complex component 7-like ... 58 7e-07 >ref|NP_200047.3| exocyst subunit exo70-A2 [Arabidopsis thaliana] gi|332008820|gb|AED96203.1| exocyst subunit exo70-A2 [Arabidopsis thaliana] Length = 631 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +1 Query: 106 METLSDQVSFMRESLHKSQTITDNMVSILGSFDHRL 213 ME L+++ S M+ESLHKSQTITDNMV ILGSFDHRL Sbjct: 7 MEALTERASLMKESLHKSQTITDNMVGILGSFDHRL 42 >dbj|BAB10531.1| unnamed protein product [Arabidopsis thaliana] Length = 608 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +1 Query: 106 METLSDQVSFMRESLHKSQTITDNMVSILGSFDHRL 213 ME L+++ S M+ESLHKSQTITDNMV ILGSFDHRL Sbjct: 7 MEALTERASLMKESLHKSQTITDNMVGILGSFDHRL 42 >ref|XP_002864165.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297310000|gb|EFH40424.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 631 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = +1 Query: 106 METLSDQVSFMRESLHKSQTITDNMVSILGSFDHRL 213 ME L+++ M+ESLHKSQTITDNMV ILGSFDHRL Sbjct: 7 MEALTERAGLMKESLHKSQTITDNMVGILGSFDHRL 42 >ref|XP_003632655.1| PREDICTED: exocyst complex component 7 isoform 2 [Vitis vinifera] Length = 640 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = +1 Query: 106 METLSDQVSFMRESLHKSQTITDNMVSILGSFDHRL 213 M+TLS++ +F RESL KSQTITD+MV+ILGSFDHRL Sbjct: 7 MQTLSERAAFTRESLQKSQTITDSMVAILGSFDHRL 42 >ref|XP_003543669.1| PREDICTED: exocyst complex component 7-like isoform 2 [Glycine max] Length = 627 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = +1 Query: 106 METLSDQVSFMRESLHKSQTITDNMVSILGSFDHRL 213 M+ L + F++ESLHKSQTITDNMVSILGSFDHRL Sbjct: 7 MDALRQRAVFVKESLHKSQTITDNMVSILGSFDHRL 42