BLASTX nr result
ID: Cimicifuga21_contig00032034
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00032034 (402 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514196.1| conserved hypothetical protein [Ricinus comm... 55 6e-06 >ref|XP_002514196.1| conserved hypothetical protein [Ricinus communis] gi|223546652|gb|EEF48150.1| conserved hypothetical protein [Ricinus communis] Length = 421 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/50 (54%), Positives = 29/50 (58%) Frame = -2 Query: 401 QVGVQHVTCXXXXXXXXXXXXXXXXXXXACRLFSHKLRKELCHDQQDYLS 252 Q+GVQHVTC ACRLFSHKLRKELCHD+QD S Sbjct: 372 QIGVQHVTCMADAALFIALSAAIDLSMDACRLFSHKLRKELCHDEQDSFS 421