BLASTX nr result
ID: Cimicifuga21_contig00031928
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00031928 (434 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004135465.1| PREDICTED: putative pentatricopeptide repeat... 152 4e-35 ref|XP_003631282.1| PREDICTED: putative pentatricopeptide repeat... 150 1e-34 ref|XP_003530680.1| PREDICTED: putative pentatricopeptide repeat... 147 1e-33 ref|NP_001031987.1| pentatricopeptide repeat-containing protein ... 144 1e-32 gb|EEE55297.1| hypothetical protein OsJ_03249 [Oryza sativa Japo... 139 2e-31 >ref|XP_004135465.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g40405-like [Cucumis sativus] Length = 614 Score = 152 bits (383), Expect = 4e-35 Identities = 67/82 (81%), Positives = 76/82 (92%) Frame = +1 Query: 1 DINEEEKEDALCRHSEKVAIAFGLISLDDSVPIRIVKNLRVCGDCHDVTKLISKLFSREI 180 DI EEEKEDALC+HSEK+AIAFGL SL + +PIRIVKNLR+C DCHDV+K+ISK+F REI Sbjct: 533 DIEEEEKEDALCKHSEKMAIAFGLFSLKEGLPIRIVKNLRICWDCHDVSKMISKIFEREI 592 Query: 181 IVRDRNRFHHFKDGECSCKDYW 246 IVRDRNRFHHFKDGECSCKD+W Sbjct: 593 IVRDRNRFHHFKDGECSCKDFW 614 >ref|XP_003631282.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g40405-like [Vitis vinifera] Length = 615 Score = 150 bits (379), Expect = 1e-34 Identities = 68/82 (82%), Positives = 73/82 (89%) Frame = +1 Query: 1 DINEEEKEDALCRHSEKVAIAFGLISLDDSVPIRIVKNLRVCGDCHDVTKLISKLFSREI 180 DI EEEKEDALC HSEK+AIAFGLISL VPIRIVKNLRVC DCHD TK+ISK F+REI Sbjct: 534 DIEEEEKEDALCMHSEKIAIAFGLISLSPDVPIRIVKNLRVCWDCHDATKMISKAFNREI 593 Query: 181 IVRDRNRFHHFKDGECSCKDYW 246 +VRDRNRFHHF+DGECSCK YW Sbjct: 594 VVRDRNRFHHFRDGECSCKGYW 615 >ref|XP_003530680.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g40405-like [Glycine max] Length = 616 Score = 147 bits (370), Expect = 1e-33 Identities = 67/82 (81%), Positives = 74/82 (90%) Frame = +1 Query: 1 DINEEEKEDALCRHSEKVAIAFGLISLDDSVPIRIVKNLRVCGDCHDVTKLISKLFSREI 180 DI EEEKEDAL +HSEKVAIAFGLISL VPIR+V NLR+C DCH+V K+ISK+F+REI Sbjct: 535 DIEEEEKEDALSKHSEKVAIAFGLISLKGVVPIRVVMNLRICWDCHNVAKMISKIFNREI 594 Query: 181 IVRDRNRFHHFKDGECSCKDYW 246 IVRDRNRFHHFKDGECSCKDYW Sbjct: 595 IVRDRNRFHHFKDGECSCKDYW 616 >ref|NP_001031987.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75171830|sp|Q9FND7.1|PP410_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At5g40405 gi|10178152|dbj|BAB11597.1| selenium-binding protein-like [Arabidopsis thaliana] gi|332007161|gb|AED94544.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 612 Score = 144 bits (362), Expect = 1e-32 Identities = 64/82 (78%), Positives = 73/82 (89%) Frame = +1 Query: 1 DINEEEKEDALCRHSEKVAIAFGLISLDDSVPIRIVKNLRVCGDCHDVTKLISKLFSREI 180 DI+EEEKEDALC HSEK AIAFG++SL + VPIRIVKNLRVCGDCH V+ +ISK+F+REI Sbjct: 531 DIDEEEKEDALCLHSEKAAIAFGIMSLKEDVPIRIVKNLRVCGDCHQVSMMISKIFNREI 590 Query: 181 IVRDRNRFHHFKDGECSCKDYW 246 IVRDRNRFHHFKDG CSC +W Sbjct: 591 IVRDRNRFHHFKDGHCSCNGFW 612 >gb|EEE55297.1| hypothetical protein OsJ_03249 [Oryza sativa Japonica Group] Length = 706 Score = 139 bits (350), Expect = 2e-31 Identities = 61/82 (74%), Positives = 73/82 (89%) Frame = +1 Query: 1 DINEEEKEDALCRHSEKVAIAFGLISLDDSVPIRIVKNLRVCGDCHDVTKLISKLFSREI 180 DI EE+KEDA+ HSEK+AIAFGL++L + + IRIVKNLRVC DCHD TK+ISK+F+REI Sbjct: 625 DIEEEDKEDAISLHSEKLAIAFGLVALPEDMEIRIVKNLRVCEDCHDYTKMISKVFNREI 684 Query: 181 IVRDRNRFHHFKDGECSCKDYW 246 ++RDRNRFHHFKDG CSCKDYW Sbjct: 685 VMRDRNRFHHFKDGACSCKDYW 706