BLASTX nr result
ID: Cimicifuga21_contig00031762
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00031762 (273 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN68458.1| hypothetical protein VITISV_031449 [Vitis vinifera] 62 4e-08 ref|XP_002282552.2| PREDICTED: UPF0481 protein At3g47200-like [V... 59 3e-07 emb|CBI21015.3| unnamed protein product [Vitis vinifera] 59 3e-07 gb|AFK44688.1| unknown [Medicago truncatula] 59 5e-07 ref|XP_003603426.1| hypothetical protein MTR_3g107590 [Medicago ... 59 5e-07 >emb|CAN68458.1| hypothetical protein VITISV_031449 [Vitis vinifera] Length = 439 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/53 (50%), Positives = 38/53 (71%) Frame = +3 Query: 114 GDADCHLAIDINKMLQKVPLLPTQCCIYKVPVNLRSENKAAYTPKVVSIGPLH 272 G+AD LA IN+ L + LP+QCCIY+VP LR N+ A+ P+++SIGP+H Sbjct: 18 GNADSLLAASINEKLSSLTSLPSQCCIYRVPDTLRRVNEEAFVPRILSIGPVH 70 >ref|XP_002282552.2| PREDICTED: UPF0481 protein At3g47200-like [Vitis vinifera] Length = 440 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/47 (57%), Positives = 33/47 (70%) Frame = +3 Query: 132 LAIDINKMLQKVPLLPTQCCIYKVPVNLRSENKAAYTPKVVSIGPLH 272 +A + ML+K+ L T CCIY+VP LR N AYTP+VVSIGPLH Sbjct: 9 VATSLQGMLEKLTPLSTTCCIYRVPQKLRKANMEAYTPRVVSIGPLH 55 >emb|CBI21015.3| unnamed protein product [Vitis vinifera] Length = 474 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/47 (57%), Positives = 33/47 (70%) Frame = +3 Query: 132 LAIDINKMLQKVPLLPTQCCIYKVPVNLRSENKAAYTPKVVSIGPLH 272 +A + ML+K+ L T CCIY+VP LR N AYTP+VVSIGPLH Sbjct: 9 VATSLQGMLEKLTPLSTTCCIYRVPQKLRKANMEAYTPRVVSIGPLH 55 >gb|AFK44688.1| unknown [Medicago truncatula] Length = 430 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/45 (62%), Positives = 33/45 (73%), Gaps = 1/45 (2%) Frame = +3 Query: 141 DINKMLQKV-PLLPTQCCIYKVPVNLRSENKAAYTPKVVSIGPLH 272 +IN MLQK P + + CCIYKVP +RS N AYTPKV+SIGP H Sbjct: 10 NINSMLQKAEPPVTSDCCIYKVPFAIRSLNPDAYTPKVISIGPFH 54 >ref|XP_003603426.1| hypothetical protein MTR_3g107590 [Medicago truncatula] gi|355492474|gb|AES73677.1| hypothetical protein MTR_3g107590 [Medicago truncatula] Length = 430 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/45 (62%), Positives = 33/45 (73%), Gaps = 1/45 (2%) Frame = +3 Query: 141 DINKMLQKV-PLLPTQCCIYKVPVNLRSENKAAYTPKVVSIGPLH 272 +IN MLQK P + + CCIYKVP +RS N AYTPKV+SIGP H Sbjct: 10 NINSMLQKAEPPVTSDCCIYKVPFAIRSLNPDAYTPKVISIGPFH 54