BLASTX nr result
ID: Cimicifuga21_contig00031603
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00031603 (377 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514685.1| conserved hypothetical protein [Ricinus comm... 58 7e-07 >ref|XP_002514685.1| conserved hypothetical protein [Ricinus communis] gi|223546289|gb|EEF47791.1| conserved hypothetical protein [Ricinus communis] Length = 142 Score = 58.2 bits (139), Expect = 7e-07 Identities = 38/98 (38%), Positives = 54/98 (55%), Gaps = 4/98 (4%) Frame = -3 Query: 375 DSYELRAVTQQLNRTIQGSQVMYSPCPTHLKF-TYPFRG-CLDRVYKENAKTPKRITDSK 202 DSYE RAVT+QLN+ +Q + S PT + + PF LD +YKEN++T KRI S+ Sbjct: 48 DSYEFRAVTEQLNKAMQS---LNSSSPTFMSYLKSPFYSHRLDSIYKENSETQKRIMCSR 104 Query: 201 VVD--SKMEEGKSSTTPAKRNFMPRLWKKFKRTILSTK 94 + S + + + F RLWKK K +L +K Sbjct: 105 INQRYSDKKASRKGSRVMSGGFASRLWKKIKEGLLWSK 142