BLASTX nr result
ID: Cimicifuga21_contig00031537
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00031537 (359 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632122.1| PREDICTED: pentatricopeptide repeat-containi... 60 2e-07 >ref|XP_003632122.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Vitis vinifera] Length = 577 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/54 (51%), Positives = 37/54 (68%) Frame = -3 Query: 288 EVGF*ISSVSQIGLQDFYSKIGELASVKQLFNEMPERDVVACNAMIATLGMHGY 127 ++GF + Q GL DFY+K+G+L K++F MP RDVVA NAMI+ L HGY Sbjct: 38 KMGFEYDMILQTGLLDFYAKVGDLKCAKRVFMGMPRRDVVANNAMISALSKHGY 91