BLASTX nr result
ID: Cimicifuga21_contig00031491
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00031491 (545 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530460.1| transcription cofactor, putative [Ricinus co... 64 2e-08 ref|XP_002271720.2| PREDICTED: uncharacterized protein LOC100264... 63 3e-08 gb|AAN62354.1|AF506028_23 CTV.22 [Citrus trifoliata] 62 8e-08 ref|XP_002298206.1| predicted protein [Populus trichocarpa] gi|2... 59 4e-07 ref|XP_003597955.1| hypothetical protein MTR_2g104400 [Medicago ... 57 1e-06 >ref|XP_002530460.1| transcription cofactor, putative [Ricinus communis] gi|223530005|gb|EEF31930.1| transcription cofactor, putative [Ricinus communis] Length = 1382 Score = 63.5 bits (153), Expect = 2e-08 Identities = 33/49 (67%), Positives = 40/49 (81%) Frame = +1 Query: 328 QLKSGPYFHISSPQHLQAVSPRASQHSSPQTDQQSLISSTLSKSGTPLQ 474 Q+K G F ISSPQ LQA SP+ +QHSSPQ DQQ+L+SS L+K+GTPLQ Sbjct: 953 QMKPGASFPISSPQLLQAASPQLTQHSSPQIDQQNLLSS-LTKTGTPLQ 1000 >ref|XP_002271720.2| PREDICTED: uncharacterized protein LOC100264243 [Vitis vinifera] Length = 1671 Score = 62.8 bits (151), Expect = 3e-08 Identities = 33/49 (67%), Positives = 39/49 (79%) Frame = +1 Query: 328 QLKSGPYFHISSPQHLQAVSPRASQHSSPQTDQQSLISSTLSKSGTPLQ 474 QLKSG F ISSPQ LQ SP+ QHSSPQ DQQ+L++S L+K+GTPLQ Sbjct: 1241 QLKSGTSFPISSPQLLQTASPQIPQHSSPQIDQQNLLTS-LTKAGTPLQ 1288 >gb|AAN62354.1|AF506028_23 CTV.22 [Citrus trifoliata] Length = 1405 Score = 61.6 bits (148), Expect = 8e-08 Identities = 34/52 (65%), Positives = 39/52 (75%), Gaps = 1/52 (1%) Frame = +1 Query: 322 SHQ-LKSGPYFHISSPQHLQAVSPRASQHSSPQTDQQSLISSTLSKSGTPLQ 474 SHQ LK G F ISSPQ LQ SP+ QHSSPQ DQQ+L+ S ++KSGTPLQ Sbjct: 973 SHQPLKPGAQFPISSPQLLQTASPQIPQHSSPQVDQQNLLQS-ITKSGTPLQ 1023 >ref|XP_002298206.1| predicted protein [Populus trichocarpa] gi|222845464|gb|EEE83011.1| predicted protein [Populus trichocarpa] Length = 772 Score = 59.3 bits (142), Expect = 4e-07 Identities = 31/49 (63%), Positives = 37/49 (75%) Frame = +1 Query: 328 QLKSGPYFHISSPQHLQAVSPRASQHSSPQTDQQSLISSTLSKSGTPLQ 474 Q+K G F ISSPQ LQ SP+ QHSSPQ DQQ+L+ S L+K+GTPLQ Sbjct: 349 QMKPGSSFPISSPQMLQHASPQLQQHSSPQIDQQNLLPS-LTKTGTPLQ 396 >ref|XP_003597955.1| hypothetical protein MTR_2g104400 [Medicago truncatula] gi|355487003|gb|AES68206.1| hypothetical protein MTR_2g104400 [Medicago truncatula] Length = 1289 Score = 57.4 bits (137), Expect = 1e-06 Identities = 31/49 (63%), Positives = 38/49 (77%) Frame = +1 Query: 328 QLKSGPYFHISSPQHLQAVSPRASQHSSPQTDQQSLISSTLSKSGTPLQ 474 QLK GP F +SSPQ LQA SP+ SQHSSPQ DQQ+ + S ++K GTP+Q Sbjct: 863 QLKQGP-FPVSSPQLLQATSPQISQHSSPQVDQQNHLPS-VTKVGTPMQ 909