BLASTX nr result
ID: Cimicifuga21_contig00031489
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00031489 (656 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531573.1| set domain protein, putative [Ricinus commun... 67 3e-09 ref|XP_004164844.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger ... 65 1e-08 ref|XP_004148557.1| PREDICTED: zinc finger CCCH domain-containin... 65 1e-08 ref|XP_004146545.1| PREDICTED: zinc finger CCCH domain-containin... 62 1e-07 ref|XP_002313012.1| predicted protein [Populus trichocarpa] gi|2... 62 1e-07 >ref|XP_002531573.1| set domain protein, putative [Ricinus communis] gi|223528803|gb|EEF30809.1| set domain protein, putative [Ricinus communis] Length = 1058 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/58 (50%), Positives = 41/58 (70%) Frame = -1 Query: 461 DSKKLWLYEDPLGRKQGPFSLKQLRI*TSSGHFSVHLRIWRSSEPRAVSRRLVDVLEG 288 +++K+WLY+DP G+ QGPFS+ QLR +S GHF H R+WR+ E + S L D L+G Sbjct: 995 ETQKMWLYQDPSGKIQGPFSIVQLRKWSSKGHFPPHFRVWRTGEKQDDSILLTDALDG 1052 >ref|XP_004164844.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing protein 19-like [Cucumis sativus] Length = 1475 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/73 (42%), Positives = 48/73 (65%) Frame = -1 Query: 461 DSKKLWLYEDPLGRKQGPFSLKQLRI*TSSGHFSVHLRIWRSSEPRAVSRRLVDVLEGAS 282 +S+K+W Y+DP G+ QGPFS+ QLR +++G+F LRIWR S+ + S L DVL G Sbjct: 890 ESEKIWHYQDPSGKVQGPFSMVQLRKWSNTGYFPTDLRIWRISDQQEDSLLLTDVLAGKI 949 Query: 281 SSEKLISNQRVDV 243 S + +++ + V Sbjct: 950 SKDTPLTSNSLQV 962 >ref|XP_004148557.1| PREDICTED: zinc finger CCCH domain-containing protein 19-like [Cucumis sativus] Length = 1470 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/73 (42%), Positives = 48/73 (65%) Frame = -1 Query: 461 DSKKLWLYEDPLGRKQGPFSLKQLRI*TSSGHFSVHLRIWRSSEPRAVSRRLVDVLEGAS 282 +S+K+W Y+DP G+ QGPFS+ QLR +++G+F LRIWR S+ + S L DVL G Sbjct: 890 ESEKIWHYQDPSGKVQGPFSMVQLRKWSNTGYFPTDLRIWRISDQQEDSLLLTDVLAGKI 949 Query: 281 SSEKLISNQRVDV 243 S + +++ + V Sbjct: 950 SKDTPLTSNSLQV 962 >ref|XP_004146545.1| PREDICTED: zinc finger CCCH domain-containing protein 44-like [Cucumis sativus] gi|449515257|ref|XP_004164666.1| PREDICTED: zinc finger CCCH domain-containing protein 44-like [Cucumis sativus] Length = 1201 Score = 62.0 bits (149), Expect = 1e-07 Identities = 31/82 (37%), Positives = 48/82 (58%) Frame = -1 Query: 467 NADSKKLWLYEDPLGRKQGPFSLKQLRI*TSSGHFSVHLRIWRSSEPRAVSRRLVDVLEG 288 +A+ +++W Y+DP G+ QGPFS+ QLR +SGHF+ LR+WR +E + S L + L G Sbjct: 745 DAEVERIWQYQDPTGKVQGPFSMTQLRNWNNSGHFTPDLRVWRITESQNDSVLLTNALNG 804 Query: 287 ASSSEKLISNQRVDVVSSGVSS 222 + I ++S G S Sbjct: 805 CYNKASSIWQPNNHLLSLGRGS 826 >ref|XP_002313012.1| predicted protein [Populus trichocarpa] gi|222849420|gb|EEE86967.1| predicted protein [Populus trichocarpa] Length = 746 Score = 62.0 bits (149), Expect = 1e-07 Identities = 28/63 (44%), Positives = 43/63 (68%) Frame = -1 Query: 461 DSKKLWLYEDPLGRKQGPFSLKQLRI*TSSGHFSVHLRIWRSSEPRAVSRRLVDVLEGAS 282 +++K+W Y+DP G+ QGPFS+ QLR +++G+F LRIWR++E + S L D L G Sbjct: 179 EAEKIWHYKDPSGKNQGPFSMVQLRKWSNTGYFPADLRIWRNTETKDDSILLTDALSGNF 238 Query: 281 SSE 273 S+ Sbjct: 239 QSD 241