BLASTX nr result
ID: Cimicifuga21_contig00030457
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00030457 (400 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510608.1| conserved hypothetical protein [Ricinus comm... 52 6e-09 ref|XP_002300676.1| predicted protein [Populus trichocarpa] gi|2... 51 6e-09 ref|XP_002510609.1| conserved hypothetical protein [Ricinus comm... 50 3e-08 ref|XP_002300674.1| predicted protein [Populus trichocarpa] gi|2... 43 3e-08 ref|XP_002510618.1| ubiquitin-protein ligase, putative [Ricinus ... 43 8e-08 >ref|XP_002510608.1| conserved hypothetical protein [Ricinus communis] gi|223551309|gb|EEF52795.1| conserved hypothetical protein [Ricinus communis] Length = 406 Score = 52.0 bits (123), Expect(2) = 6e-09 Identities = 27/46 (58%), Positives = 31/46 (67%) Frame = -2 Query: 138 FFNLSDNKAYRLEFPEVIGKGKRCWGSPHGWLVILHEDGPLFSLLN 1 F+NL+D K Y LE PE I K RC GS HGWLV++ ED P LLN Sbjct: 67 FYNLADGKTYHLELPETIEK--RCCGSSHGWLVMV-EDTPSIFLLN 109 Score = 33.1 bits (74), Expect(2) = 6e-09 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = -3 Query: 236 SNLPKNPRHLPTQLPWLLLPHFTN 165 S +PK P L QLPWLLLP+ N Sbjct: 37 SAIPKKPHDLLCQLPWLLLPYHKN 60 >ref|XP_002300676.1| predicted protein [Populus trichocarpa] gi|222842402|gb|EEE79949.1| predicted protein [Populus trichocarpa] Length = 305 Score = 50.8 bits (120), Expect(2) = 6e-09 Identities = 24/44 (54%), Positives = 29/44 (65%) Frame = -2 Query: 138 FFNLSDNKAYRLEFPEVIGKGKRCWGSPHGWLVILHEDGPLFSL 7 F+NL+D K YRLE PE K RC GS HGWLV++ E +F L Sbjct: 67 FYNLADGKTYRLELPEAYEK--RCCGSSHGWLVMVEETPAIFLL 108 Score = 34.3 bits (77), Expect(2) = 6e-09 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -3 Query: 239 RSNLPKNPRHLPTQLPWLLLPH 174 RS LPK P L QLPWLLLP+ Sbjct: 36 RSALPKKPHDLLCQLPWLLLPY 57 >ref|XP_002510609.1| conserved hypothetical protein [Ricinus communis] gi|223551310|gb|EEF52796.1| conserved hypothetical protein [Ricinus communis] Length = 406 Score = 50.4 bits (119), Expect(2) = 3e-08 Identities = 26/46 (56%), Positives = 30/46 (65%) Frame = -2 Query: 138 FFNLSDNKAYRLEFPEVIGKGKRCWGSPHGWLVILHEDGPLFSLLN 1 F+N SD K Y LE PE + K RC GS HGWLV++ ED P LLN Sbjct: 67 FYNPSDGKTYHLELPETVDK--RCCGSSHGWLVMV-EDTPSIFLLN 109 Score = 32.3 bits (72), Expect(2) = 3e-08 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -3 Query: 236 SNLPKNPRHLPTQLPWLLLPH 174 S +PK P L +LPWLLLPH Sbjct: 37 SAIPKKPHDLLCRLPWLLLPH 57 >ref|XP_002300674.1| predicted protein [Populus trichocarpa] gi|222842400|gb|EEE79947.1| predicted protein [Populus trichocarpa] Length = 393 Score = 42.7 bits (99), Expect(2) = 3e-08 Identities = 22/47 (46%), Positives = 29/47 (61%) Frame = -2 Query: 141 SFFNLSDNKAYRLEFPEVIGKGKRCWGSPHGWLVILHEDGPLFSLLN 1 +FFNLS K + L PE + K C GS HGWL+IL +D P ++N Sbjct: 68 AFFNLSTYKFHSLNLPEASHRKKHC-GSSHGWLIIL-DDSPSILVIN 112 Score = 40.0 bits (92), Expect(2) = 3e-08 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = -3 Query: 239 RSNLPKNPRHLPTQLPWLLLP 177 +S++PK P HLP QLPWLLLP Sbjct: 37 KSSIPKTPNHLPPQLPWLLLP 57 >ref|XP_002510618.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223551319|gb|EEF52805.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 398 Score = 43.1 bits (100), Expect(2) = 8e-08 Identities = 23/47 (48%), Positives = 31/47 (65%) Frame = -2 Query: 141 SFFNLSDNKAYRLEFPEVIGKGKRCWGSPHGWLVILHEDGPLFSLLN 1 +FF+LS NK + L PEV + + C GS HGWL+IL +D P L+N Sbjct: 69 AFFSLSTNKFHFLNLPEVSYRKRHC-GSSHGWLMIL-DDTPTILLIN 113 Score = 38.1 bits (87), Expect(2) = 8e-08 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -3 Query: 239 RSNLPKNPRHLPTQLPWLLLP 177 R ++PK P HLP QLPWL+LP Sbjct: 37 RFSIPKTPNHLPPQLPWLMLP 57