BLASTX nr result
ID: Cimicifuga21_contig00030443
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00030443 (333 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513467.1| ubiquitin-protein ligase, putative [Ricinus ... 56 3e-06 >ref|XP_002513467.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223547375|gb|EEF48870.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 464 Score = 56.2 bits (134), Expect = 3e-06 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%) Frame = -2 Query: 212 ERCKFVRWVDWILQLDYSPVIESFRLQFHMNKDFADLIDQWISMAIAKSVQRFDIDLSHF 33 ER FV WV+ +L+ P +E R+ F ++ DF ID WI++A+ K V+R +IDL++ Sbjct: 99 ERHSFVSWVNQVLRSHEGPTMEGLRICFDLDSDFMYEIDSWITIAMQKRVKRLEIDLTNI 158 Query: 32 YP-WPDRGSYA 3 P GSYA Sbjct: 159 EPSIKTTGSYA 169