BLASTX nr result
ID: Cimicifuga21_contig00030406
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00030406 (267 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEO09337.4| alpha-amylase [Musa acuminata AAA Group] 70 2e-10 ref|XP_002327139.1| predicted protein [Populus trichocarpa] gi|2... 70 2e-10 gb|AAO11776.1| alpha-amylase precursor [Musa acuminata] 70 2e-10 ref|XP_002510218.1| alpha-amylase, putative [Ricinus communis] g... 70 2e-10 gb|AAN01149.1| alpha-amylase precursor [Musa acuminata] 69 3e-10 >gb|AEO09337.4| alpha-amylase [Musa acuminata AAA Group] Length = 416 Score = 70.1 bits (170), Expect = 2e-10 Identities = 30/65 (46%), Positives = 44/65 (67%) Frame = +3 Query: 39 FFYVCIAMKSNSENFVLFFYNKGFNWESWNREERWYNFLKKSVPDLAQIGITHVWLPPSS 218 F + + + + +++ +LF +GFNWESW ++ WYNFLK V D+A G+THVWLPP S Sbjct: 2 FLLLLLVVPNLAQSQILF---QGFNWESWRQQGGWYNFLKDKVSDIANAGVTHVWLPPPS 58 Query: 219 NSGAV 233 +S V Sbjct: 59 HSVGV 63 >ref|XP_002327139.1| predicted protein [Populus trichocarpa] gi|222835454|gb|EEE73889.1| predicted protein [Populus trichocarpa] Length = 423 Score = 70.1 bits (170), Expect = 2e-10 Identities = 33/53 (62%), Positives = 39/53 (73%) Frame = +3 Query: 72 SENFVLFFYNKGFNWESWNREERWYNFLKKSVPDLAQIGITHVWLPPSSNSGA 230 + +++LF +GFNWES N+ WYN LK SVPDLA GITHVWLPPSS S A Sbjct: 20 TSSYLLF---QGFNWESCNKAGGWYNSLKNSVPDLANAGITHVWLPPSSQSVA 69 >gb|AAO11776.1| alpha-amylase precursor [Musa acuminata] Length = 416 Score = 69.7 bits (169), Expect = 2e-10 Identities = 30/65 (46%), Positives = 44/65 (67%) Frame = +3 Query: 39 FFYVCIAMKSNSENFVLFFYNKGFNWESWNREERWYNFLKKSVPDLAQIGITHVWLPPSS 218 F + + + + +++ +LF +GFNWESW ++ WYNFLK V D+A G+THVWLPP S Sbjct: 2 FLLLFLVIPNLAQSQILF---QGFNWESWRQQGGWYNFLKDKVSDIANAGVTHVWLPPPS 58 Query: 219 NSGAV 233 +S V Sbjct: 59 HSVGV 63 >ref|XP_002510218.1| alpha-amylase, putative [Ricinus communis] gi|223550919|gb|EEF52405.1| alpha-amylase, putative [Ricinus communis] Length = 422 Score = 69.7 bits (169), Expect = 2e-10 Identities = 35/64 (54%), Positives = 41/64 (64%) Frame = +3 Query: 39 FFYVCIAMKSNSENFVLFFYNKGFNWESWNREERWYNFLKKSVPDLAQIGITHVWLPPSS 218 +FY+ + VLF +GFNWES N+E WYN LK VPD+A GITHVWLPPSS Sbjct: 6 WFYLLSIFPLYTSAAVLF---QGFNWESCNKEGGWYNSLKNFVPDIASAGITHVWLPPSS 62 Query: 219 NSGA 230 S A Sbjct: 63 QSVA 66 >gb|AAN01149.1| alpha-amylase precursor [Musa acuminata] Length = 416 Score = 69.3 bits (168), Expect = 3e-10 Identities = 30/65 (46%), Positives = 44/65 (67%) Frame = +3 Query: 39 FFYVCIAMKSNSENFVLFFYNKGFNWESWNREERWYNFLKKSVPDLAQIGITHVWLPPSS 218 F + + + + +++ +LF +GFNWESW ++ WYNFLK V D+A G+THVWLPP S Sbjct: 2 FLLLFLVILNLAQSQILF---QGFNWESWRQQGGWYNFLKDKVSDIANAGVTHVWLPPPS 58 Query: 219 NSGAV 233 +S V Sbjct: 59 HSVGV 63