BLASTX nr result
ID: Cimicifuga21_contig00030224
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00030224 (481 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513134.1| conserved hypothetical protein [Ricinus comm... 69 4e-10 >ref|XP_002513134.1| conserved hypothetical protein [Ricinus communis] gi|223548145|gb|EEF49637.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 68.9 bits (167), Expect = 4e-10 Identities = 35/68 (51%), Positives = 44/68 (64%) Frame = +1 Query: 22 MEVPCLYFDPTLVFQSGKKRFRSLFRRVRAEVQRKVKNXXXXXXXKQGRFHYDPFSYSLN 201 M V FDP GK++FRSLF RVRAE++R++K ++ F YDP SY+LN Sbjct: 1 MSVMRFCFDPNAALLWGKRKFRSLFWRVRAEIRRQMKRRSK----QRFSFQYDPLSYALN 56 Query: 202 FDNGNFGF 225 FDNGNFGF Sbjct: 57 FDNGNFGF 64