BLASTX nr result
ID: Cimicifuga21_contig00030185
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00030185 (594 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003556095.1| PREDICTED: DUF246 domain-containing protein ... 82 5e-14 ref|XP_003529417.1| PREDICTED: DUF246 domain-containing protein ... 80 3e-13 ref|XP_002311505.1| predicted protein [Populus trichocarpa] gi|2... 79 4e-13 ref|XP_002284457.1| PREDICTED: DUF246 domain-containing protein ... 79 4e-13 ref|XP_002526030.1| conserved hypothetical protein [Ricinus comm... 79 6e-13 >ref|XP_003556095.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Glycine max] Length = 564 Score = 82.4 bits (202), Expect = 5e-14 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = -3 Query: 592 LSMRSHSDAKGVELKRPNDSIYSFPCPDCMCRVNKTEETKSPPA 461 LSMRSHSD+KGVELKRPNDSIYSFPCPDCMCR N+T++++S A Sbjct: 520 LSMRSHSDSKGVELKRPNDSIYSFPCPDCMCRANRTDDSRSSSA 563 >ref|XP_003529417.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Glycine max] Length = 564 Score = 80.1 bits (196), Expect = 3e-13 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = -3 Query: 592 LSMRSHSDAKGVELKRPNDSIYSFPCPDCMCRVNKTEETKS 470 LSMRSHSD+KGVELKRPNDSIYSFPCPDCMCR N+T++ +S Sbjct: 520 LSMRSHSDSKGVELKRPNDSIYSFPCPDCMCRSNRTDDLRS 560 >ref|XP_002311505.1| predicted protein [Populus trichocarpa] gi|222851325|gb|EEE88872.1| predicted protein [Populus trichocarpa] Length = 569 Score = 79.3 bits (194), Expect = 4e-13 Identities = 33/44 (75%), Positives = 40/44 (90%) Frame = -3 Query: 592 LSMRSHSDAKGVELKRPNDSIYSFPCPDCMCRVNKTEETKSPPA 461 L+MRSHSD+KG E+KRPNDSIYSFPCPDCMC VN+TE+++S A Sbjct: 525 LNMRSHSDSKGFEIKRPNDSIYSFPCPDCMCHVNRTEDSRSSSA 568 >ref|XP_002284457.1| PREDICTED: DUF246 domain-containing protein At1g04910 [Vitis vinifera] gi|297737694|emb|CBI26895.3| unnamed protein product [Vitis vinifera] Length = 561 Score = 79.3 bits (194), Expect = 4e-13 Identities = 33/44 (75%), Positives = 41/44 (93%) Frame = -3 Query: 592 LSMRSHSDAKGVELKRPNDSIYSFPCPDCMCRVNKTEETKSPPA 461 L+MR+HSDAKG ELKRPNDSIY+FPCPDCMCR+NK+E+++S A Sbjct: 517 LNMRAHSDAKGFELKRPNDSIYTFPCPDCMCRMNKSEDSRSSSA 560 >ref|XP_002526030.1| conserved hypothetical protein [Ricinus communis] gi|223534677|gb|EEF36370.1| conserved hypothetical protein [Ricinus communis] Length = 570 Score = 79.0 bits (193), Expect = 6e-13 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = -3 Query: 592 LSMRSHSDAKGVELKRPNDSIYSFPCPDCMCRVNKTEETKS 470 L+MRSHSD+KG ELKRPNDSIYSFPCPDCMCR+NKTE S Sbjct: 528 LNMRSHSDSKGFELKRPNDSIYSFPCPDCMCRMNKTESRSS 568