BLASTX nr result
ID: Cimicifuga21_contig00029874
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00029874 (352 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271965.2| PREDICTED: uncharacterized protein LOC100249... 62 5e-08 emb|CAN61978.1| hypothetical protein VITISV_038568 [Vitis vinifera] 62 6e-08 emb|CAN68902.1| hypothetical protein VITISV_031323 [Vitis vinifera] 62 6e-08 emb|CAN78062.1| hypothetical protein VITISV_036399 [Vitis vinifera] 61 1e-07 emb|CAN65706.1| hypothetical protein VITISV_001745 [Vitis vinifera] 61 1e-07 >ref|XP_002271965.2| PREDICTED: uncharacterized protein LOC100249130 [Vitis vinifera] Length = 2143 Score = 62.0 bits (149), Expect = 5e-08 Identities = 24/48 (50%), Positives = 33/48 (68%) Frame = -2 Query: 147 KVCFFLWALLRRKILTVDNLIKRGLTIPNRCSMCCQAEENIPHLFLEC 4 KVCFF W K+LT+D L KRG + NRC +CC+ EE+I H+ ++C Sbjct: 1806 KVCFFAWEAFGGKVLTLDQLKKRGRCLANRCFLCCEEEESIDHILIQC 1853 >emb|CAN61978.1| hypothetical protein VITISV_038568 [Vitis vinifera] Length = 731 Score = 61.6 bits (148), Expect = 6e-08 Identities = 24/48 (50%), Positives = 33/48 (68%) Frame = -2 Query: 147 KVCFFLWALLRRKILTVDNLIKRGLTIPNRCSMCCQAEENIPHLFLEC 4 KVCFF W K+LT+D L KRG + NRC +CC+ EE+I H+ ++C Sbjct: 577 KVCFFAWEAFWGKVLTLDQLKKRGRCLANRCFLCCEEEESIDHILIQC 624 >emb|CAN68902.1| hypothetical protein VITISV_031323 [Vitis vinifera] Length = 1206 Score = 61.6 bits (148), Expect = 6e-08 Identities = 24/48 (50%), Positives = 33/48 (68%) Frame = -2 Query: 147 KVCFFLWALLRRKILTVDNLIKRGLTIPNRCSMCCQAEENIPHLFLEC 4 KVCFF W K+LT+D L KRG + NRC +CC+ EE+I H+ ++C Sbjct: 453 KVCFFAWEAFWGKVLTLDQLKKRGRCLANRCFLCCEEEESIDHILIQC 500 >emb|CAN78062.1| hypothetical protein VITISV_036399 [Vitis vinifera] Length = 522 Score = 60.8 bits (146), Expect = 1e-07 Identities = 24/48 (50%), Positives = 32/48 (66%) Frame = -2 Query: 147 KVCFFLWALLRRKILTVDNLIKRGLTIPNRCSMCCQAEENIPHLFLEC 4 KVCFF W K+LT+D L KRG + NRC +CC+ EE+I H+ + C Sbjct: 368 KVCFFAWEASWGKVLTMDQLKKRGXAVVNRCFLCCEEEESIDHILIHC 415 >emb|CAN65706.1| hypothetical protein VITISV_001745 [Vitis vinifera] Length = 982 Score = 60.8 bits (146), Expect = 1e-07 Identities = 24/48 (50%), Positives = 32/48 (66%) Frame = -2 Query: 147 KVCFFLWALLRRKILTVDNLIKRGLTIPNRCSMCCQAEENIPHLFLEC 4 KVCFF W K+LT+D L KRG + NRC +CC+ EE+I H+ + C Sbjct: 707 KVCFFAWEASWGKVLTMDQLKKRGWAVANRCFLCCEEEESIDHILIHC 754