BLASTX nr result
ID: Cimicifuga21_contig00029836
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00029836 (640 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002298791.1| predicted protein [Populus trichocarpa] gi|2... 62 1e-07 emb|CBI25129.3| unnamed protein product [Vitis vinifera] 61 2e-07 ref|XP_002271890.1| PREDICTED: uncharacterized protein LOC100241... 61 2e-07 ref|XP_002522110.1| sterol regulatory element-binding protein si... 61 2e-07 ref|NP_173229.1| ethylene-dependent gravitropism-deficient and y... 60 5e-07 >ref|XP_002298791.1| predicted protein [Populus trichocarpa] gi|222846049|gb|EEE83596.1| predicted protein [Populus trichocarpa] Length = 108 Score = 61.6 bits (148), Expect = 1e-07 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 2/61 (3%) Frame = +1 Query: 436 MQIESAMPSTHWGYVSVIVL-LCKF*DMALMSDFFLKPDATFDDYLADVS-LFWWFSFRI 609 +Q ES ST WGY+S IVL + F +ALMS FFLKP+ATFDDY+ADV+ LF F + Sbjct: 45 LQFESIKLSTPWGYISAIVLCVATFGTIALMSGFFLKPNATFDDYIADVAPLFGGFLTIL 104 Query: 610 G 612 G Sbjct: 105 G 105 >emb|CBI25129.3| unnamed protein product [Vitis vinifera] Length = 456 Score = 61.2 bits (147), Expect = 2e-07 Identities = 32/49 (65%), Positives = 37/49 (75%), Gaps = 1/49 (2%) Frame = +1 Query: 436 MQIESAMPSTHWGYVSVIVL-LCKF*DMALMSDFFLKPDATFDDYLADV 579 +Q ES ST WGY+S IVL + F +ALMS FFLKP+ATFDDYLADV Sbjct: 144 LQFESTKLSTPWGYISSIVLCVATFGTIALMSGFFLKPNATFDDYLADV 192 >ref|XP_002271890.1| PREDICTED: uncharacterized protein LOC100241185 [Vitis vinifera] gi|147804805|emb|CAN73523.1| hypothetical protein VITISV_010704 [Vitis vinifera] Length = 579 Score = 61.2 bits (147), Expect = 2e-07 Identities = 32/49 (65%), Positives = 37/49 (75%), Gaps = 1/49 (2%) Frame = +1 Query: 436 MQIESAMPSTHWGYVSVIVL-LCKF*DMALMSDFFLKPDATFDDYLADV 579 +Q ES ST WGY+S IVL + F +ALMS FFLKP+ATFDDYLADV Sbjct: 267 LQFESTKLSTPWGYISSIVLCVATFGTIALMSGFFLKPNATFDDYLADV 315 >ref|XP_002522110.1| sterol regulatory element-binding protein site 2 protease, putative [Ricinus communis] gi|223538709|gb|EEF40310.1| sterol regulatory element-binding protein site 2 protease, putative [Ricinus communis] Length = 613 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/49 (61%), Positives = 36/49 (73%), Gaps = 1/49 (2%) Frame = +1 Query: 436 MQIESAMPSTHWGYVSVIVL-LCKF*DMALMSDFFLKPDATFDDYLADV 579 +Q ES ST WGY+S + L + F +ALMS FFLKPDATFDDY+ADV Sbjct: 301 LQFESTKLSTPWGYISAVALCVTTFGTIALMSGFFLKPDATFDDYIADV 349 >ref|NP_173229.1| ethylene-dependent gravitropism-deficient and yellow-green-like 3 protein [Arabidopsis thaliana] gi|9665065|gb|AAF97267.1|AC034106_10 F2H15.10 [Arabidopsis thaliana] gi|332191525|gb|AEE29646.1| ethylene-dependent gravitropism-deficient and yellow-green-like 3 protein [Arabidopsis thaliana] Length = 573 Score = 59.7 bits (143), Expect = 5e-07 Identities = 31/49 (63%), Positives = 36/49 (73%), Gaps = 1/49 (2%) Frame = +1 Query: 436 MQIESAMPSTHWGYVSVIVL-LCKF*DMALMSDFFLKPDATFDDYLADV 579 +Q ES ST WGYVS I L + F +ALMS FFLKPDATFDDY+A+V Sbjct: 260 LQFESTRLSTPWGYVSAIALCVTTFGTIALMSGFFLKPDATFDDYIANV 308