BLASTX nr result
ID: Cimicifuga21_contig00029696
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00029696 (342 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002981967.1| hypothetical protein SELMODRAFT_115352 [Sela... 62 5e-08 ref|XP_002981966.1| hypothetical protein SELMODRAFT_421332 [Sela... 62 6e-08 gb|ADJ53037.1| antimicrobial peptide 1 [Pinus pinaster] 61 8e-08 ref|XP_002981870.1| hypothetical protein SELMODRAFT_115640 [Sela... 61 1e-07 gb|ABK21585.1| unknown [Picea sitchensis] gi|116790086|gb|ABK254... 60 1e-07 >ref|XP_002981967.1| hypothetical protein SELMODRAFT_115352 [Selaginella moellendorffii] gi|300150409|gb|EFJ17060.1| hypothetical protein SELMODRAFT_115352 [Selaginella moellendorffii] Length = 84 Score = 62.0 bits (149), Expect = 5e-08 Identities = 26/47 (55%), Positives = 31/47 (65%) Frame = -2 Query: 335 GGYQFRYTGQSARMYNTGNCLGGSVFTFNGNSRQCSGVGWKSMFIQC 195 GGY F Y GQ+A YNT NC G + F+G+ + CSG GW S FIQC Sbjct: 38 GGYSFAYQGQTAAAYNTANCQGVAHTRFSGSVQDCSGFGWNSFFIQC 84 >ref|XP_002981966.1| hypothetical protein SELMODRAFT_421332 [Selaginella moellendorffii] gi|300150408|gb|EFJ17059.1| hypothetical protein SELMODRAFT_421332 [Selaginella moellendorffii] Length = 101 Score = 61.6 bits (148), Expect = 6e-08 Identities = 26/47 (55%), Positives = 31/47 (65%) Frame = -2 Query: 335 GGYQFRYTGQSARMYNTGNCLGGSVFTFNGNSRQCSGVGWKSMFIQC 195 GGY F Y GQ+A YNT NC G + F+G+ + CSG GW S FIQC Sbjct: 55 GGYSFGYQGQTAAAYNTANCQGVAHTRFSGSVQDCSGFGWNSFFIQC 101 >gb|ADJ53037.1| antimicrobial peptide 1 [Pinus pinaster] Length = 105 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/48 (58%), Positives = 33/48 (68%), Gaps = 1/48 (2%) Frame = -2 Query: 335 GGYQFRYTGQSARMYNTGNCLGGSVFTFNGNSRQ-CSGVGWKSMFIQC 195 GGY+F Y GQ+A YNT NC G + F+G+ Q CSG GWKS FIQC Sbjct: 58 GGYEFVYQGQTASAYNTANCKGVAQTRFSGSVNQACSGFGWKSFFIQC 105 >ref|XP_002981870.1| hypothetical protein SELMODRAFT_115640 [Selaginella moellendorffii] gi|300150312|gb|EFJ16963.1| hypothetical protein SELMODRAFT_115640 [Selaginella moellendorffii] Length = 84 Score = 60.8 bits (146), Expect = 1e-07 Identities = 25/47 (53%), Positives = 32/47 (68%) Frame = -2 Query: 335 GGYQFRYTGQSARMYNTGNCLGGSVFTFNGNSRQCSGVGWKSMFIQC 195 GGY F Y GQ+A YNT NC G + F+ + + CSG GW+S+FIQC Sbjct: 38 GGYSFAYQGQTAAAYNTANCRGVAHTRFSSSVQDCSGFGWRSIFIQC 84 >gb|ABK21585.1| unknown [Picea sitchensis] gi|116790086|gb|ABK25496.1| unknown [Picea sitchensis] gi|224285051|gb|ACN40253.1| unknown [Picea sitchensis] Length = 105 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/48 (58%), Positives = 33/48 (68%), Gaps = 1/48 (2%) Frame = -2 Query: 335 GGYQFRYTGQSARMYNTGNCLGGSVFTFNGNSRQ-CSGVGWKSMFIQC 195 GGY+F Y GQ+A YNT NC G + F+G+ Q CSG GWKS FIQC Sbjct: 58 GGYEFVYQGQTASAYNTANCNGVAHTRFSGSVNQACSGFGWKSFFIQC 105