BLASTX nr result
ID: Cimicifuga21_contig00029494
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00029494 (254 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI25339.3| unnamed protein product [Vitis vinifera] 68 7e-10 ref|XP_002320185.1| predicted protein [Populus trichocarpa] gi|2... 65 6e-09 ref|XP_003553779.1| PREDICTED: uncharacterized protein LOC100795... 65 8e-09 ref|XP_003520868.1| PREDICTED: uncharacterized protein LOC100814... 64 2e-08 ref|XP_002533909.1| hypothetical protein RCOM_0237030 [Ricinus c... 63 2e-08 >emb|CBI25339.3| unnamed protein product [Vitis vinifera] Length = 1185 Score = 68.2 bits (165), Expect = 7e-10 Identities = 27/42 (64%), Positives = 37/42 (88%) Frame = +3 Query: 114 IMASKATKVRLVRCPKCLKILPELAHLPVYQCGGCGITLKAK 239 +++ ATK+RLVRCPKC K+LPE+A +P+YQCGGCG+ L+AK Sbjct: 1 MISGPATKIRLVRCPKCWKLLPEVAGIPLYQCGGCGVFLRAK 42 >ref|XP_002320185.1| predicted protein [Populus trichocarpa] gi|222860958|gb|EEE98500.1| predicted protein [Populus trichocarpa] Length = 778 Score = 65.1 bits (157), Expect = 6e-09 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = +3 Query: 123 SKATKVRLVRCPKCLKILPELAHLPVYQCGGCGITLKAKRRPED 254 +++TKVRLVRCPKC +LPELA VYQCGGCG L+AK + D Sbjct: 2 AESTKVRLVRCPKCENLLPELADYSVYQCGGCGAVLRAKNKNRD 45 >ref|XP_003553779.1| PREDICTED: uncharacterized protein LOC100795121 [Glycine max] Length = 911 Score = 64.7 bits (156), Expect = 8e-09 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = +3 Query: 117 MASKATKVRLVRCPKCLKILPELAHLPVYQCGGCGITLKAKRR 245 M+ A KVRLVRCPKC +LPELA VYQCGGCG L+AK + Sbjct: 1 MSDSANKVRLVRCPKCQNLLPELADYSVYQCGGCGAVLRAKHK 43 >ref|XP_003520868.1| PREDICTED: uncharacterized protein LOC100814647 [Glycine max] Length = 904 Score = 63.5 bits (153), Expect = 2e-08 Identities = 27/43 (62%), Positives = 32/43 (74%) Frame = +3 Query: 117 MASKATKVRLVRCPKCLKILPELAHLPVYQCGGCGITLKAKRR 245 M+ A K+RLVRCPKC +LPELA VYQCGGCG L+AK + Sbjct: 1 MSDSANKLRLVRCPKCQNLLPELADYSVYQCGGCGAVLRAKHK 43 >ref|XP_002533909.1| hypothetical protein RCOM_0237030 [Ricinus communis] gi|223526130|gb|EEF28474.1| hypothetical protein RCOM_0237030 [Ricinus communis] Length = 916 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = +3 Query: 129 ATKVRLVRCPKCLKILPELAHLPVYQCGGCGITLKAKRRPED 254 +TKVRLVRCPKC +LPELA VYQCGGCG L+AK + D Sbjct: 4 STKVRLVRCPKCENLLPELADYSVYQCGGCGAVLRAKDKNPD 45