BLASTX nr result
ID: Cimicifuga21_contig00029466
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00029466 (347 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN65986.1| hypothetical protein VITISV_042143 [Vitis vinifera] 86 3e-20 ref|XP_002534720.1| conserved hypothetical protein [Ricinus comm... 93 2e-17 >emb|CAN65986.1| hypothetical protein VITISV_042143 [Vitis vinifera] Length = 138 Score = 85.9 bits (211), Expect(2) = 3e-20 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = +1 Query: 13 GGGITPFSKEPYVTLSRHTAPSRNQDLPFPLTNGSSNQPV 132 GGGITPFSKEPYVTLSRHTAPSRN+DLPFPLTNGSSNQPV Sbjct: 20 GGGITPFSKEPYVTLSRHTAPSRNKDLPFPLTNGSSNQPV 59 Score = 37.4 bits (85), Expect(2) = 3e-20 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 147 PFHSFID*FKVALACFQAQALAVEASRQK 233 PF+S VA+ACFQ QALAVEASRQK Sbjct: 61 PFYS-----SVAVACFQVQALAVEASRQK 84 >ref|XP_002534720.1| conserved hypothetical protein [Ricinus communis] gi|223524693|gb|EEF27662.1| conserved hypothetical protein [Ricinus communis] Length = 77 Score = 93.2 bits (230), Expect = 2e-17 Identities = 42/50 (84%), Positives = 44/50 (88%), Gaps = 1/50 (2%) Frame = +3 Query: 3 GPDRWWYHTLLKGTVRDTLASYGSVPESG-PPLSFDQRVLEPTCPCMEVP 149 GPDRWWYHTLLKGTVRDTLASYGS PESG PP SFDQRVLEPT P ++ P Sbjct: 9 GPDRWWYHTLLKGTVRDTLASYGSAPESGPPPFSFDQRVLEPTFPALDAP 58