BLASTX nr result
ID: Cimicifuga21_contig00029455
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00029455 (741 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003625779.1| LRR and BTB/POZ domain-containing protein FB... 60 5e-07 ref|XP_002534000.1| ubiquitin-protein ligase, putative [Ricinus ... 60 6e-07 emb|CBI30274.3| unnamed protein product [Vitis vinifera] 59 8e-07 ref|XP_002277002.1| PREDICTED: BTB/POZ domain-containing protein... 59 8e-07 emb|CAN68472.1| hypothetical protein VITISV_009362 [Vitis vinifera] 59 8e-07 >ref|XP_003625779.1| LRR and BTB/POZ domain-containing protein FBL11 [Medicago truncatula] gi|355500794|gb|AES81997.1| LRR and BTB/POZ domain-containing protein FBL11 [Medicago truncatula] Length = 1039 Score = 60.1 bits (144), Expect = 5e-07 Identities = 33/79 (41%), Positives = 47/79 (59%), Gaps = 1/79 (1%) Frame = +2 Query: 428 EVVQRGDV-ETENCIIGTAVKCFCKSFPSLRALKASYCLHYKMTTVFHLLQNCPQVNEVY 604 E VQ D+ + +I AV CF +SFPSLR LKA+Y L+ + T LL+ C VNEV Sbjct: 402 EAVQEVDISKCRRLLIEHAVNCFSQSFPSLRILKAAYLLNIRTTGFLQLLEKCSLVNEVD 461 Query: 605 LAAATRLVLPAQVSAISTN 661 L ++PA V+ +S++ Sbjct: 462 LTVDVTPLIPASVTILSSS 480 >ref|XP_002534000.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223526002|gb|EEF28381.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 846 Score = 59.7 bits (143), Expect = 6e-07 Identities = 30/78 (38%), Positives = 50/78 (64%), Gaps = 1/78 (1%) Frame = +2 Query: 428 EVVQRGDV-ETENCIIGTAVKCFCKSFPSLRALKASYCLHYKMTTVFHLLQNCPQVNEVY 604 E V++ D+ + + + ++ F KSFPSLR L+A+Y L++K T+ L+QNCP ++EV Sbjct: 319 EAVEKVDISKCPRLHLESTIEFFSKSFPSLRKLRAAYLLNFKTITLHKLMQNCPLISEVD 378 Query: 605 LAAATRLVLPAQVSAIST 658 L ++P Q+S IS+ Sbjct: 379 LTVDITPLIPTQLSVISS 396 >emb|CBI30274.3| unnamed protein product [Vitis vinifera] Length = 1010 Score = 59.3 bits (142), Expect = 8e-07 Identities = 35/81 (43%), Positives = 51/81 (62%), Gaps = 3/81 (3%) Frame = +2 Query: 428 EVVQRGDVETENCI---IGTAVKCFCKSFPSLRALKASYCLHYKMTTVFHLLQNCPQVNE 598 E VQ DV+ C A++CFCKSFP+LR L+A+Y L+ KMT++ L++ C ++E Sbjct: 399 EAVQ--DVDISKCSRLHFEAAIECFCKSFPALRTLRAAYLLNIKMTSLRQLVK-CSLLSE 455 Query: 599 VYLAAATRLVLPAQVSAISTN 661 V L V+P QVS IS++ Sbjct: 456 VDLTVDVSPVIPMQVSIISSS 476 >ref|XP_002277002.1| PREDICTED: BTB/POZ domain-containing protein FBL11-like [Vitis vinifera] Length = 980 Score = 59.3 bits (142), Expect = 8e-07 Identities = 35/81 (43%), Positives = 51/81 (62%), Gaps = 3/81 (3%) Frame = +2 Query: 428 EVVQRGDVETENCI---IGTAVKCFCKSFPSLRALKASYCLHYKMTTVFHLLQNCPQVNE 598 E VQ DV+ C A++CFCKSFP+LR L+A+Y L+ KMT++ L++ C ++E Sbjct: 369 EAVQ--DVDISKCSRLHFEAAIECFCKSFPALRTLRAAYLLNIKMTSLRQLVK-CSLLSE 425 Query: 599 VYLAAATRLVLPAQVSAISTN 661 V L V+P QVS IS++ Sbjct: 426 VDLTVDVSPVIPMQVSIISSS 446 >emb|CAN68472.1| hypothetical protein VITISV_009362 [Vitis vinifera] Length = 871 Score = 59.3 bits (142), Expect = 8e-07 Identities = 35/81 (43%), Positives = 51/81 (62%), Gaps = 3/81 (3%) Frame = +2 Query: 428 EVVQRGDVETENCI---IGTAVKCFCKSFPSLRALKASYCLHYKMTTVFHLLQNCPQVNE 598 E VQ DV+ C A++CFCKSFP+LR L+A+Y L+ KMT++ L++ C ++E Sbjct: 287 EAVQ--DVDISKCSRLHFEAAIECFCKSFPALRTLRAAYLLNIKMTSLRQLVK-CSLLSE 343 Query: 599 VYLAAATRLVLPAQVSAISTN 661 V L V+P QVS IS++ Sbjct: 344 VDLTVDVSPVIPMQVSIISSS 364