BLASTX nr result
ID: Cimicifuga21_contig00029412
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00029412 (267 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002873822.1| hypothetical protein ARALYDRAFT_909725 [Arab... 97 4e-21 sp|Q9SDX3.1|UGPA_MUSAC RecName: Full=UTP--glucose-1-phosphate ur... 96 6e-21 ref|NP_197233.1| UTP--glucose-1-phosphate uridylyltransferase 1 ... 96 8e-21 dbj|BAJ34372.1| unnamed protein product [Thellungiella halophila] 96 8e-21 ref|NP_850837.1| UTP--glucose-1-phosphate uridylyltransferase 1 ... 96 8e-21 >ref|XP_002873822.1| hypothetical protein ARALYDRAFT_909725 [Arabidopsis lyrata subsp. lyrata] gi|297319659|gb|EFH50081.1| hypothetical protein ARALYDRAFT_909725 [Arabidopsis lyrata subsp. lyrata] Length = 469 Score = 96.7 bits (239), Expect(2) = 4e-21 Identities = 49/71 (69%), Positives = 54/71 (76%) Frame = -2 Query: 215 AKSFEFFLQSDLYAFVDGQFVRNIARISSTNPVIELGPEFKHVANFSSRFKTIPSIAELG 36 A S +QSDLY VDG +RN AR + TNP IELGPEFK VA+F SRFK+IPSI EL Sbjct: 361 ATSDLLLVQSDLYTLVDGFVIRNKARTNPTNPAIELGPEFKKVASFLSRFKSIPSIVELD 420 Query: 35 SLKVSGDVWFG 3 SLKVSGDVWFG Sbjct: 421 SLKVSGDVWFG 431 Score = 29.6 bits (65), Expect(2) = 4e-21 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 267 PRSRFLPAKTTADLVVV 217 PRSRFLP K T+DL++V Sbjct: 352 PRSRFLPVKATSDLLLV 368 >sp|Q9SDX3.1|UGPA_MUSAC RecName: Full=UTP--glucose-1-phosphate uridylyltransferase; AltName: Full=UDP-glucose pyrophosphorylase; Short=UDPGP; Short=UGPase gi|6625908|gb|AAF19422.1|AF203909_1 UDP-glucose pyrophosphorylase [Musa acuminata] Length = 467 Score = 95.9 bits (237), Expect(2) = 6e-21 Identities = 49/71 (69%), Positives = 54/71 (76%) Frame = -2 Query: 215 AKSFEFFLQSDLYAFVDGQFVRNIARISSTNPVIELGPEFKHVANFSSRFKTIPSIAELG 36 A S +QSDLY VDG +RN AR + +NP IELGPEFK VANF SRFK+IPSI EL Sbjct: 359 ATSDLLLVQSDLYMLVDGFVIRNKARTNPSNPSIELGPEFKKVANFLSRFKSIPSIVELD 418 Query: 35 SLKVSGDVWFG 3 SLKVSGDVWFG Sbjct: 419 SLKVSGDVWFG 429 Score = 29.6 bits (65), Expect(2) = 6e-21 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 267 PRSRFLPAKTTADLVVV 217 PRSRFLP K T+DL++V Sbjct: 350 PRSRFLPVKATSDLLLV 366 >ref|NP_197233.1| UTP--glucose-1-phosphate uridylyltransferase 1 [Arabidopsis thaliana] gi|12585448|sp|P57751.1|UGPA1_ARATH RecName: Full=UTP--glucose-1-phosphate uridylyltransferase 1; AltName: Full=UDP-glucose pyrophosphorylase 1; Short=UDPGP 1; Short=UGPase 1 gi|13430664|gb|AAK25954.1|AF360244_1 putative UDP-glucose pyrophosphorylase [Arabidopsis thaliana] gi|13605671|gb|AAK32829.1|AF361816_1 AT5g17310/MKP11_16 [Arabidopsis thaliana] gi|10177076|dbj|BAB10518.1| UDP-glucose pyrophosphorylase [Arabidopsis thaliana] gi|14532836|gb|AAK64100.1| putative UDP-glucose pyrophosphorylase [Arabidopsis thaliana] gi|332005029|gb|AED92412.1| UTP--glucose-1-phosphate uridylyltransferase 1 [Arabidopsis thaliana] Length = 470 Score = 95.5 bits (236), Expect(2) = 8e-21 Identities = 49/71 (69%), Positives = 53/71 (74%) Frame = -2 Query: 215 AKSFEFFLQSDLYAFVDGQFVRNIARISSTNPVIELGPEFKHVANFSSRFKTIPSIAELG 36 A S +QSDLY VDG RN AR + TNP IELGPEFK VA+F SRFK+IPSI EL Sbjct: 362 ATSDLLLVQSDLYTLVDGFVTRNKARTNPTNPAIELGPEFKKVASFLSRFKSIPSIVELD 421 Query: 35 SLKVSGDVWFG 3 SLKVSGDVWFG Sbjct: 422 SLKVSGDVWFG 432 Score = 29.6 bits (65), Expect(2) = 8e-21 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 267 PRSRFLPAKTTADLVVV 217 PRSRFLP K T+DL++V Sbjct: 353 PRSRFLPVKATSDLLLV 369 >dbj|BAJ34372.1| unnamed protein product [Thellungiella halophila] Length = 469 Score = 95.5 bits (236), Expect(2) = 8e-21 Identities = 49/71 (69%), Positives = 53/71 (74%) Frame = -2 Query: 215 AKSFEFFLQSDLYAFVDGQFVRNIARISSTNPVIELGPEFKHVANFSSRFKTIPSIAELG 36 A S +QSDLY VDG RN AR + TNP IELGPEFK VA+F SRFK+IPSI EL Sbjct: 361 ATSDLLLVQSDLYTLVDGFVTRNKARTNPTNPAIELGPEFKKVASFLSRFKSIPSIVELD 420 Query: 35 SLKVSGDVWFG 3 SLKVSGDVWFG Sbjct: 421 SLKVSGDVWFG 431 Score = 29.6 bits (65), Expect(2) = 8e-21 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 267 PRSRFLPAKTTADLVVV 217 PRSRFLP K T+DL++V Sbjct: 352 PRSRFLPVKATSDLLLV 368 >ref|NP_850837.1| UTP--glucose-1-phosphate uridylyltransferase 1 [Arabidopsis thaliana] gi|332005028|gb|AED92411.1| UTP--glucose-1-phosphate uridylyltransferase 1 [Arabidopsis thaliana] Length = 390 Score = 95.5 bits (236), Expect(2) = 8e-21 Identities = 49/71 (69%), Positives = 53/71 (74%) Frame = -2 Query: 215 AKSFEFFLQSDLYAFVDGQFVRNIARISSTNPVIELGPEFKHVANFSSRFKTIPSIAELG 36 A S +QSDLY VDG RN AR + TNP IELGPEFK VA+F SRFK+IPSI EL Sbjct: 282 ATSDLLLVQSDLYTLVDGFVTRNKARTNPTNPAIELGPEFKKVASFLSRFKSIPSIVELD 341 Query: 35 SLKVSGDVWFG 3 SLKVSGDVWFG Sbjct: 342 SLKVSGDVWFG 352 Score = 29.6 bits (65), Expect(2) = 8e-21 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 267 PRSRFLPAKTTADLVVV 217 PRSRFLP K T+DL++V Sbjct: 273 PRSRFLPVKATSDLLLV 289