BLASTX nr result
ID: Cimicifuga21_contig00029200
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00029200 (435 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530076.1| monoxygenase, putative [Ricinus communis] gi... 59 5e-07 ref|XP_002530075.1| monoxygenase, putative [Ricinus communis] gi... 58 9e-07 ref|XP_002530077.1| monoxygenase, putative [Ricinus communis] gi... 57 2e-06 ref|XP_002530074.1| monoxygenase, putative [Ricinus communis] gi... 56 3e-06 >ref|XP_002530076.1| monoxygenase, putative [Ricinus communis] gi|223530429|gb|EEF32316.1| monoxygenase, putative [Ricinus communis] Length = 390 Score = 58.5 bits (140), Expect = 5e-07 Identities = 24/55 (43%), Positives = 39/55 (70%) Frame = -2 Query: 434 GWIQQGGSGWLMEFLRDKVFYKFFSHLTNNAVYHNCGKLPNAFLTTEVDTTKKSE 270 GW+QQ GS WLM+FLRD +FY+F + A++++CG LP A ++++ KK++ Sbjct: 337 GWVQQEGSNWLMKFLRDAIFYRFLFPKLSRAIFYDCGTLPTA-SADQLNSYKKTD 390 >ref|XP_002530075.1| monoxygenase, putative [Ricinus communis] gi|223530428|gb|EEF32315.1| monoxygenase, putative [Ricinus communis] Length = 408 Score = 57.8 bits (138), Expect = 9e-07 Identities = 25/42 (59%), Positives = 30/42 (71%) Frame = -2 Query: 434 GWIQQGGSGWLMEFLRDKVFYKFFSHLTNNAVYHNCGKLPNA 309 GW QQGGS WLM+FLRD VFY F ++AV ++CG LP A Sbjct: 355 GWFQQGGSNWLMKFLRDVVFYGFLFRKLSSAVLYDCGTLPAA 396 >ref|XP_002530077.1| monoxygenase, putative [Ricinus communis] gi|223530430|gb|EEF32317.1| monoxygenase, putative [Ricinus communis] Length = 462 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/42 (57%), Positives = 29/42 (69%) Frame = -2 Query: 434 GWIQQGGSGWLMEFLRDKVFYKFFSHLTNNAVYHNCGKLPNA 309 GWIQQ GS W M+FLRD +FY F NAV ++CG LP+A Sbjct: 410 GWIQQSGSNWWMKFLRDAIFYGFLFRKVLNAVVYDCGTLPSA 451 >ref|XP_002530074.1| monoxygenase, putative [Ricinus communis] gi|223530427|gb|EEF32314.1| monoxygenase, putative [Ricinus communis] Length = 412 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/42 (54%), Positives = 29/42 (69%) Frame = -2 Query: 434 GWIQQGGSGWLMEFLRDKVFYKFFSHLTNNAVYHNCGKLPNA 309 GW+QQ GS W M+FLRD +FY F N+V ++CGKLP A Sbjct: 359 GWVQQSGSNWWMKFLRDFIFYGFLFRKVFNSVVYDCGKLPTA 400