BLASTX nr result
ID: Cimicifuga21_contig00029172
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00029172 (226 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004167707.1| PREDICTED: DUF246 domain-containing protein ... 69 9e-14 ref|XP_004152592.1| PREDICTED: DUF246 domain-containing protein ... 69 9e-14 gb|ADN33952.1| hypothetical protein [Cucumis melo subsp. melo] 69 9e-14 emb|CBI15631.3| unnamed protein product [Vitis vinifera] 64 2e-13 ref|XP_002279576.1| PREDICTED: DUF246 domain-containing protein ... 64 2e-13 >ref|XP_004167707.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis sativus] Length = 559 Score = 68.6 bits (166), Expect(3) = 9e-14 Identities = 35/50 (70%), Positives = 40/50 (80%) Frame = +3 Query: 48 NYIISLSSDVFMPSQSHGGNMGCAMQGHRAYNGHRKYLKTHCLSSRMLQY 197 +YI+SLSSDVFMPS HGGNMG AMQGHRAY GHRKY+K + ML+Y Sbjct: 465 DYIVSLSSDVFMPS--HGGNMGRAMQGHRAYVGHRKYIKPN--KRAMLEY 510 Score = 26.6 bits (57), Expect(3) = 9e-14 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = +1 Query: 1 GELAPYLNKSSVLTAI 48 GEL+P++NKSS + AI Sbjct: 449 GELSPFINKSSAMAAI 464 Score = 25.8 bits (55), Expect(3) = 9e-14 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +2 Query: 170 LPFFEDASISSAEFDTIMR 226 L +F+DASIS E TI+R Sbjct: 508 LEYFDDASISETELGTIVR 526 >ref|XP_004152592.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis sativus] Length = 559 Score = 68.6 bits (166), Expect(3) = 9e-14 Identities = 35/50 (70%), Positives = 40/50 (80%) Frame = +3 Query: 48 NYIISLSSDVFMPSQSHGGNMGCAMQGHRAYNGHRKYLKTHCLSSRMLQY 197 +YI+SLSSDVFMPS HGGNMG AMQGHRAY GHRKY+K + ML+Y Sbjct: 465 DYIVSLSSDVFMPS--HGGNMGRAMQGHRAYVGHRKYIKPN--KRAMLEY 510 Score = 26.6 bits (57), Expect(3) = 9e-14 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = +1 Query: 1 GELAPYLNKSSVLTAI 48 GEL+P++NKSS + AI Sbjct: 449 GELSPFINKSSAMAAI 464 Score = 25.8 bits (55), Expect(3) = 9e-14 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +2 Query: 170 LPFFEDASISSAEFDTIMR 226 L +F+DASIS E TI+R Sbjct: 508 LEYFDDASISETELGTIVR 526 >gb|ADN33952.1| hypothetical protein [Cucumis melo subsp. melo] Length = 465 Score = 68.6 bits (166), Expect(3) = 9e-14 Identities = 35/50 (70%), Positives = 40/50 (80%) Frame = +3 Query: 48 NYIISLSSDVFMPSQSHGGNMGCAMQGHRAYNGHRKYLKTHCLSSRMLQY 197 +YI+SLSSDVFMPS HGGNMG AMQGHRAY GHRKY+K + ML+Y Sbjct: 371 DYIVSLSSDVFMPS--HGGNMGRAMQGHRAYVGHRKYIKPN--KRAMLEY 416 Score = 26.6 bits (57), Expect(3) = 9e-14 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = +1 Query: 1 GELAPYLNKSSVLTAI 48 GEL+P++NKSS + AI Sbjct: 355 GELSPFINKSSAMAAI 370 Score = 25.8 bits (55), Expect(3) = 9e-14 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +2 Query: 170 LPFFEDASISSAEFDTIMR 226 L +F+DASIS E TI+R Sbjct: 414 LEYFDDASISETELGTIVR 432 >emb|CBI15631.3| unnamed protein product [Vitis vinifera] Length = 562 Score = 64.3 bits (155), Expect(3) = 2e-13 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = +3 Query: 48 NYIISLSSDVFMPSQSHGGNMGCAMQGHRAYNGHRKYLK 164 +YI+SLSSDVF+PS HGGNMG AMQGHRAY GHRK++K Sbjct: 459 DYIVSLSSDVFLPS--HGGNMGRAMQGHRAYVGHRKFVK 495 Score = 32.0 bits (71), Expect(3) = 2e-13 Identities = 14/22 (63%), Positives = 18/22 (81%) Frame = +2 Query: 161 KDSLPFFEDASISSAEFDTIMR 226 ++ + FFEDASIS AEF +IMR Sbjct: 499 REMIAFFEDASISEAEFRSIMR 520 Score = 23.9 bits (50), Expect(3) = 2e-13 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = +1 Query: 1 GELAPYLNKSSVLTAI 48 GEL+PY+N+ S + A+ Sbjct: 443 GELSPYVNRPSAMAAL 458 >ref|XP_002279576.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Vitis vinifera] Length = 433 Score = 64.3 bits (155), Expect(3) = 2e-13 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = +3 Query: 48 NYIISLSSDVFMPSQSHGGNMGCAMQGHRAYNGHRKYLK 164 +YI+SLSSDVF+PS HGGNMG AMQGHRAY GHRK++K Sbjct: 330 DYIVSLSSDVFLPS--HGGNMGRAMQGHRAYVGHRKFVK 366 Score = 32.0 bits (71), Expect(3) = 2e-13 Identities = 14/22 (63%), Positives = 18/22 (81%) Frame = +2 Query: 161 KDSLPFFEDASISSAEFDTIMR 226 ++ + FFEDASIS AEF +IMR Sbjct: 370 REMIAFFEDASISEAEFRSIMR 391 Score = 23.9 bits (50), Expect(3) = 2e-13 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = +1 Query: 1 GELAPYLNKSSVLTAI 48 GEL+PY+N+ S + A+ Sbjct: 314 GELSPYVNRPSAMAAL 329