BLASTX nr result
ID: Cimicifuga21_contig00029170
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00029170 (303 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN71465.1| hypothetical protein VITISV_038986 [Vitis vinifera] 92 3e-17 >emb|CAN71465.1| hypothetical protein VITISV_038986 [Vitis vinifera] Length = 564 Score = 92.4 bits (228), Expect = 3e-17 Identities = 46/53 (86%), Positives = 47/53 (88%) Frame = +3 Query: 144 KRSGANFSYLLSVVCPPFVECPARFTGLLAYQALARCSCRPLGGRSARYPYCS 302 +RSGANFSYLLSV PFVECPARFTGLLAYQALARCSCRP GRSARYPY S Sbjct: 97 ERSGANFSYLLSV--SPFVECPARFTGLLAYQALARCSCRPPSGRSARYPYFS 147