BLASTX nr result
ID: Cimicifuga21_contig00029106
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00029106 (451 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003556185.1| PREDICTED: somatic embryogenesis receptor ki... 70 2e-10 gb|AEB40066.1| somatic embryogenesis receptor kinase 1 [Cyclamen... 69 5e-10 ref|NP_001238274.1| somatic embryogenesis receptor kinase precur... 69 5e-10 gb|AEC46975.1| somatic embryogenesis receptor-like kinase [Anana... 68 9e-10 gb|ACH87659.3| somatic embryogenesis receptor kinase [Dimocarpus... 68 9e-10 >ref|XP_003556185.1| PREDICTED: somatic embryogenesis receptor kinase 1-like [Glycine max] Length = 624 Score = 69.7 bits (169), Expect = 2e-10 Identities = 34/52 (65%), Positives = 36/52 (69%) Frame = +2 Query: 296 MEQKXXXXXXXXXXXXXHPLMTINANMEGDALHSLRTNLIDPNNVLQSWDPT 451 ME+K HPL I+ANMEGDALHSLRTNL DPNNVLQSWDPT Sbjct: 1 MERKFMALGFIWWVVLVHPLCLISANMEGDALHSLRTNLQDPNNVLQSWDPT 52 >gb|AEB40066.1| somatic embryogenesis receptor kinase 1 [Cyclamen persicum] gi|334851453|gb|ABS11235.2| somatic embryogenesis receptor kinase 1 [Cyclamen persicum] Length = 628 Score = 68.6 bits (166), Expect = 5e-10 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +2 Query: 347 HPLMTINANMEGDALHSLRTNLIDPNNVLQSWDPT 451 HPLM AN+EGDALHSLRTNL+DPNNVLQSWDPT Sbjct: 22 HPLMVTLANIEGDALHSLRTNLVDPNNVLQSWDPT 56 >ref|NP_001238274.1| somatic embryogenesis receptor kinase precursor [Glycine max] gi|215260693|gb|ACJ64717.1| somatic embryogenesis receptor kinase [Glycine max] Length = 624 Score = 68.6 bits (166), Expect = 5e-10 Identities = 34/52 (65%), Positives = 35/52 (67%) Frame = +2 Query: 296 MEQKXXXXXXXXXXXXXHPLMTINANMEGDALHSLRTNLIDPNNVLQSWDPT 451 ME+K HPL I ANMEGDALHSLRTNL DPNNVLQSWDPT Sbjct: 1 MERKFMALGFIWWVVLVHPLCLIPANMEGDALHSLRTNLQDPNNVLQSWDPT 52 >gb|AEC46975.1| somatic embryogenesis receptor-like kinase [Ananas comosus] gi|375335090|gb|AFA53652.1| somatic embryogenesis receptor-like kinase 1 [Ananas comosus] Length = 629 Score = 67.8 bits (164), Expect = 9e-10 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = +2 Query: 347 HPLMTINANMEGDALHSLRTNLIDPNNVLQSWDPT 451 HPL + ANMEGDALHSLRTNL DPNNVLQSWDPT Sbjct: 22 HPLARVRANMEGDALHSLRTNLNDPNNVLQSWDPT 56 >gb|ACH87659.3| somatic embryogenesis receptor kinase [Dimocarpus longan] gi|301323231|gb|ADK70387.1| somatic embryogensis receptor kinase [Dimocarpus longan] Length = 624 Score = 67.8 bits (164), Expect = 9e-10 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +2 Query: 347 HPLMTINANMEGDALHSLRTNLIDPNNVLQSWDPT 451 HPL +++NMEGDALHSLRTNL DPNNVLQSWDPT Sbjct: 18 HPLWLVSSNMEGDALHSLRTNLTDPNNVLQSWDPT 52