BLASTX nr result
ID: Cimicifuga21_contig00029101
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00029101 (456 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002285091.1| PREDICTED: uncharacterized protein LOC100261... 71 8e-11 emb|CAN63499.1| hypothetical protein VITISV_011674 [Vitis vinifera] 71 8e-11 ref|XP_004167917.1| PREDICTED: uncharacterized LOC101212505 [Cuc... 70 2e-10 ref|XP_004150017.1| PREDICTED: uncharacterized protein LOC101212... 70 2e-10 ref|XP_002524468.1| conserved hypothetical protein [Ricinus comm... 68 9e-10 >ref|XP_002285091.1| PREDICTED: uncharacterized protein LOC100261198 [Vitis vinifera] gi|297738931|emb|CBI28176.3| unnamed protein product [Vitis vinifera] Length = 187 Score = 71.2 bits (173), Expect = 8e-11 Identities = 35/43 (81%), Positives = 35/43 (81%), Gaps = 4/43 (9%) Frame = -2 Query: 119 MSGGTPVSGGLMRQRHSQGYASSGDDLEDDACSR----GPAPP 3 MSGGTPV GG MRQRHSQGYASSGDDLEDDACSR PA P Sbjct: 1 MSGGTPVGGGFMRQRHSQGYASSGDDLEDDACSRQTPSSPAMP 43 >emb|CAN63499.1| hypothetical protein VITISV_011674 [Vitis vinifera] Length = 142 Score = 71.2 bits (173), Expect = 8e-11 Identities = 35/43 (81%), Positives = 35/43 (81%), Gaps = 4/43 (9%) Frame = -2 Query: 119 MSGGTPVSGGLMRQRHSQGYASSGDDLEDDACSR----GPAPP 3 MSGGTPV GG MRQRHSQGYASSGDDLEDDACSR PA P Sbjct: 57 MSGGTPVGGGFMRQRHSQGYASSGDDLEDDACSRQTPSSPAMP 99 >ref|XP_004167917.1| PREDICTED: uncharacterized LOC101212505 [Cucumis sativus] Length = 187 Score = 70.1 bits (170), Expect = 2e-10 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -2 Query: 119 MSGGTPVSGGLMRQRHSQGYASSGDDLEDDACSR 18 MSGGTPV+GG MRQRHSQGYASSGDD+EDDACSR Sbjct: 1 MSGGTPVAGGYMRQRHSQGYASSGDDIEDDACSR 34 >ref|XP_004150017.1| PREDICTED: uncharacterized protein LOC101212505 [Cucumis sativus] Length = 187 Score = 70.1 bits (170), Expect = 2e-10 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -2 Query: 119 MSGGTPVSGGLMRQRHSQGYASSGDDLEDDACSR 18 MSGGTPV+GG MRQRHSQGYASSGDD+EDDACSR Sbjct: 1 MSGGTPVAGGYMRQRHSQGYASSGDDIEDDACSR 34 >ref|XP_002524468.1| conserved hypothetical protein [Ricinus communis] gi|223536256|gb|EEF37908.1| conserved hypothetical protein [Ricinus communis] Length = 187 Score = 67.8 bits (164), Expect = 9e-10 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = -2 Query: 119 MSGGTPVSGGLMRQRHSQGYASSGDDLEDDACSRGPAP 6 MSGG+PV GG MRQRHSQGYAS GDDLEDDACSR P P Sbjct: 1 MSGGSPVGGGYMRQRHSQGYASGGDDLEDDACSR-PQP 37