BLASTX nr result
ID: Cimicifuga21_contig00029033
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00029033 (353 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532208.1| conserved hypothetical protein [Ricinus comm... 69 3e-10 >ref|XP_002532208.1| conserved hypothetical protein [Ricinus communis] gi|223528104|gb|EEF30177.1| conserved hypothetical protein [Ricinus communis] Length = 368 Score = 69.3 bits (168), Expect = 3e-10 Identities = 36/85 (42%), Positives = 53/85 (62%), Gaps = 1/85 (1%) Frame = +3 Query: 9 GRPWAPEKKLR-RGAVGATVGDLTTLSESKMWAKNVECGEKIEIFSRGTDEYERGKQLKE 185 GRPWA KL +G+L + K+ +N + G+ +++ G++EY+ GKQL++ Sbjct: 282 GRPWAITAKLSGHDTYLVALGNLMPKYQEKLDFRNNDTGKDLKVVCSGSEEYKTGKQLRD 341 Query: 186 LFLNFADDQRRLHHLLALDESKILQ 260 LFL FA+ QRRLH LAL+E KI Q Sbjct: 342 LFLEFAEHQRRLHKRLALEERKIFQ 366