BLASTX nr result
ID: Cimicifuga21_contig00029017
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00029017 (499 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270714.2| PREDICTED: uncharacterized protein LOC100258... 64 2e-08 emb|CBI17221.3| unnamed protein product [Vitis vinifera] 64 2e-08 emb|CAN78548.1| hypothetical protein VITISV_000123 [Vitis vinifera] 64 2e-08 ref|XP_003629669.1| hypothetical protein MTR_8g085280 [Medicago ... 61 8e-08 ref|XP_002518058.1| conserved hypothetical protein [Ricinus comm... 59 3e-07 >ref|XP_002270714.2| PREDICTED: uncharacterized protein LOC100258878 [Vitis vinifera] Length = 1578 Score = 63.5 bits (153), Expect = 2e-08 Identities = 28/42 (66%), Positives = 37/42 (88%) Frame = -1 Query: 499 SFSIAHVFLTGSNNAKVTVFKNPVRLCQQGMLRLAVLMPRSQ 374 SFSIAHV L+G+N A++T+FKNPV+LCQ G L+LAV++PR Q Sbjct: 1531 SFSIAHVVLSGNNAARITMFKNPVKLCQLGQLQLAVMIPRQQ 1572 >emb|CBI17221.3| unnamed protein product [Vitis vinifera] Length = 2388 Score = 63.5 bits (153), Expect = 2e-08 Identities = 28/42 (66%), Positives = 37/42 (88%) Frame = -1 Query: 499 SFSIAHVFLTGSNNAKVTVFKNPVRLCQQGMLRLAVLMPRSQ 374 SFSIAHV L+G+N A++T+FKNPV+LCQ G L+LAV++PR Q Sbjct: 2341 SFSIAHVVLSGNNAARITMFKNPVKLCQLGQLQLAVMIPRQQ 2382 >emb|CAN78548.1| hypothetical protein VITISV_000123 [Vitis vinifera] Length = 539 Score = 63.5 bits (153), Expect = 2e-08 Identities = 28/42 (66%), Positives = 37/42 (88%) Frame = -1 Query: 499 SFSIAHVFLTGSNNAKVTVFKNPVRLCQQGMLRLAVLMPRSQ 374 SFSIAHV L+G+N A++T+FKNPV+LCQ G L+LAV++PR Q Sbjct: 492 SFSIAHVVLSGNNAARITMFKNPVKLCQLGQLQLAVMIPRQQ 533 >ref|XP_003629669.1| hypothetical protein MTR_8g085280 [Medicago truncatula] gi|355523691|gb|AET04145.1| hypothetical protein MTR_8g085280 [Medicago truncatula] Length = 2812 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = -1 Query: 499 SFSIAHVFLTGSNNAKVTVFKNPVRLCQQGMLRLAVLMPRSQ 374 SFSIA V +TG NNA+V VFK+PV+LCQQG L+L V+MP+ Q Sbjct: 2764 SFSIAFVAITGDNNARVAVFKDPVKLCQQGGLQLVVMMPKQQ 2805 >ref|XP_002518058.1| conserved hypothetical protein [Ricinus communis] gi|223542654|gb|EEF44191.1| conserved hypothetical protein [Ricinus communis] Length = 2833 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/42 (59%), Positives = 35/42 (83%) Frame = -1 Query: 499 SFSIAHVFLTGSNNAKVTVFKNPVRLCQQGMLRLAVLMPRSQ 374 SFSIAHVFL+ +N+A+VT+F+NPV+ CQ G L+L V+MP + Sbjct: 2785 SFSIAHVFLSSNNSARVTIFRNPVKQCQAGKLQLVVMMPNQK 2826