BLASTX nr result
ID: Cimicifuga21_contig00028888
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00028888 (340 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515045.1| arginine/serine-rich splicing factor, putati... 55 6e-06 ref|XP_002314579.1| predicted protein [Populus trichocarpa] gi|2... 54 1e-05 >ref|XP_002515045.1| arginine/serine-rich splicing factor, putative [Ricinus communis] gi|223546096|gb|EEF47599.1| arginine/serine-rich splicing factor, putative [Ricinus communis] Length = 622 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = -2 Query: 126 VPIDVTHETVKRELEVFGELRAIQMERLQQDGIVTALFYDLR 1 VP +V+ ++RELEVFGE+R +QMER+ DGIVT FYDLR Sbjct: 116 VPTEVSESVIRRELEVFGEVRGVQMERI-SDGIVTVHFYDLR 156 >ref|XP_002314579.1| predicted protein [Populus trichocarpa] gi|222863619|gb|EEF00750.1| predicted protein [Populus trichocarpa] Length = 557 Score = 54.3 bits (129), Expect = 1e-05 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = -2 Query: 126 VPIDVTHETVKRELEVFGELRAIQMERLQQDGIVTALFYDLR 1 VP DV+ ++RELEVFGE+R +QMER+ DGIVT FYDLR Sbjct: 87 VPSDVSETLIRRELEVFGEVRGVQMERV-GDGIVTVHFYDLR 127