BLASTX nr result
ID: Cimicifuga21_contig00028781
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00028781 (1305 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI41029.3| unnamed protein product [Vitis vinifera] 69 2e-09 ref|XP_004145426.1| PREDICTED: ubiquinol oxidase 4, chloroplasti... 68 5e-09 gb|ACA53387.2| plastid terminal oxidase [Daucus carota] 68 6e-09 ref|XP_002271078.2| PREDICTED: alternative oxidase 4, chloroplas... 68 6e-09 ref|XP_003546171.1| PREDICTED: alternative oxidase 4, chloroplas... 68 6e-09 >emb|CBI41029.3| unnamed protein product [Vitis vinifera] Length = 2124 Score = 69.3 bits (168), Expect = 2e-09 Identities = 30/42 (71%), Positives = 32/42 (76%) Frame = -1 Query: 288 KMAFLYTLAAFTSVLHMYESFGWWRRADYLKVHLSGSWNERH 163 K FL +F SVLHMYESFGWWRRADYLKVH + SWNE H Sbjct: 1902 KPLFLICANSFMSVLHMYESFGWWRRADYLKVHFAESWNEMH 1943 >ref|XP_004145426.1| PREDICTED: ubiquinol oxidase 4, chloroplastic/chromoplastic-like [Cucumis sativus] gi|449525172|ref|XP_004169592.1| PREDICTED: ubiquinol oxidase 4, chloroplastic/chromoplastic-like [Cucumis sativus] Length = 355 Score = 68.2 bits (165), Expect = 5e-09 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 261 AFTSVLHMYESFGWWRRADYLKVHLSGSWNERH 163 AF SVLHMYESFGWWRRADYLKVH + SWNE H Sbjct: 142 AFVSVLHMYESFGWWRRADYLKVHFAESWNEMH 174 >gb|ACA53387.2| plastid terminal oxidase [Daucus carota] Length = 365 Score = 67.8 bits (164), Expect = 6e-09 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 261 AFTSVLHMYESFGWWRRADYLKVHLSGSWNERH 163 AF SVLHMYESFGWWRRADYLKVH + SWNE H Sbjct: 155 AFMSVLHMYESFGWWRRADYLKVHFAESWNEMH 187 >ref|XP_002271078.2| PREDICTED: alternative oxidase 4, chloroplastic/chromoplastic-like, partial [Vitis vinifera] Length = 281 Score = 67.8 bits (164), Expect = 6e-09 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 261 AFTSVLHMYESFGWWRRADYLKVHLSGSWNERH 163 AF SVLHMYESFGWWRRADYLKVH + SWNE H Sbjct: 144 AFMSVLHMYESFGWWRRADYLKVHFAESWNEMH 176 >ref|XP_003546171.1| PREDICTED: alternative oxidase 4, chloroplastic/chromoplastic-like [Glycine max] Length = 332 Score = 67.8 bits (164), Expect = 6e-09 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 261 AFTSVLHMYESFGWWRRADYLKVHLSGSWNERH 163 AF SVLHMYESFGWWRRADYLKVH + SWNE H Sbjct: 125 AFMSVLHMYESFGWWRRADYLKVHFAESWNEMH 157