BLASTX nr result
ID: Cimicifuga21_contig00028668
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00028668 (389 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003604006.1| Flavonol synthase/flavanone 3-hydroxylase [M... 68 7e-10 ref|XP_003527615.1| PREDICTED: uncharacterized protein LOC100815... 67 1e-09 ref|XP_003612119.1| Zinc finger CCCH domain-containing protein [... 66 3e-09 ref|XP_003612118.1| Zinc finger CCCH domain-containing protein [... 66 3e-09 ref|XP_004164844.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger ... 66 3e-09 >ref|XP_003604006.1| Flavonol synthase/flavanone 3-hydroxylase [Medicago truncatula] gi|355493054|gb|AES74257.1| Flavonol synthase/flavanone 3-hydroxylase [Medicago truncatula] Length = 1942 Score = 68.2 bits (165), Expect = 7e-10 Identities = 25/43 (58%), Positives = 35/43 (81%) Frame = +2 Query: 254 RLWHCKDPSGKIQGPFSLAQLSIWGSAGHFPLDLRVWRSGEDQ 382 ++WH +DPSGK+QGPFS+ QLS W + G+FP DLR+W++ E Q Sbjct: 1439 KMWHYQDPSGKVQGPFSMVQLSKWNNTGYFPADLRIWKTSERQ 1481 >ref|XP_003527615.1| PREDICTED: uncharacterized protein LOC100815079 [Glycine max] Length = 1421 Score = 67.0 bits (162), Expect = 1e-09 Identities = 25/43 (58%), Positives = 34/43 (79%) Frame = +2 Query: 254 RLWHCKDPSGKIQGPFSLAQLSIWGSAGHFPLDLRVWRSGEDQ 382 ++WH +DPSGK+QGPFS+ QL W + G+FP DLR+WR+ E Q Sbjct: 868 KMWHYQDPSGKVQGPFSMVQLHKWSNTGYFPADLRIWRTTEKQ 910 >ref|XP_003612119.1| Zinc finger CCCH domain-containing protein [Medicago truncatula] gi|355513454|gb|AES95077.1| Zinc finger CCCH domain-containing protein [Medicago truncatula] Length = 1255 Score = 66.2 bits (160), Expect = 3e-09 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = +2 Query: 254 RLWHCKDPSGKIQGPFSLAQLSIWGSAGHFPLDLRVWRSGEDQ 382 R WH +DPSGK+QGPFS+ QL W ++GHFP DL+VWR E Q Sbjct: 727 RSWHYQDPSGKVQGPFSMLQLYKWNASGHFPPDLKVWRVDEKQ 769 >ref|XP_003612118.1| Zinc finger CCCH domain-containing protein [Medicago truncatula] gi|355513453|gb|AES95076.1| Zinc finger CCCH domain-containing protein [Medicago truncatula] Length = 673 Score = 66.2 bits (160), Expect = 3e-09 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = +2 Query: 254 RLWHCKDPSGKIQGPFSLAQLSIWGSAGHFPLDLRVWRSGEDQ 382 R WH +DPSGK+QGPFS+ QL W ++GHFP DL+VWR E Q Sbjct: 145 RSWHYQDPSGKVQGPFSMLQLYKWNASGHFPPDLKVWRVDEKQ 187 >ref|XP_004164844.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing protein 19-like [Cucumis sativus] Length = 1475 Score = 65.9 bits (159), Expect = 3e-09 Identities = 24/43 (55%), Positives = 33/43 (76%) Frame = +2 Query: 254 RLWHCKDPSGKIQGPFSLAQLSIWGSAGHFPLDLRVWRSGEDQ 382 ++WH +DPSGK+QGPFS+ QL W + G+FP DLR+WR + Q Sbjct: 893 KIWHYQDPSGKVQGPFSMVQLRKWSNTGYFPTDLRIWRISDQQ 935