BLASTX nr result
ID: Cimicifuga21_contig00028658
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00028658 (318 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515850.1| conserved hypothetical protein [Ricinus comm... 55 5e-06 >ref|XP_002515850.1| conserved hypothetical protein [Ricinus communis] gi|223545005|gb|EEF46519.1| conserved hypothetical protein [Ricinus communis] Length = 284 Score = 55.5 bits (132), Expect = 5e-06 Identities = 35/78 (44%), Positives = 46/78 (58%), Gaps = 3/78 (3%) Frame = -3 Query: 226 TSPLTRANGSSSPTTVLGCCDGAVLEQNTDL--PAEPYT-LLCNRVRVYPRKPVLKFAKG 56 T+P GS S D +L NT++ P P + LLC RVR+YP P + F KG Sbjct: 201 TAPTLFKEGSMSSDIATMESDSHLLSSNTNMGKPEAPESYLLCERVRMYPSYPNIDFPKG 260 Query: 55 ITVLPISDDDKWVAVSLD 2 ITVLPI+ D+ WVAV+L+ Sbjct: 261 ITVLPIT-DNIWVAVNLE 277