BLASTX nr result
ID: Cimicifuga21_contig00028536
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00028536 (238 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAH67225.1| OSIGBa0145M07.7 [Oryza sativa Indica Group] 60 2e-07 emb|CAN66999.1| hypothetical protein VITISV_019171 [Vitis vinifera] 55 8e-06 >emb|CAH67225.1| OSIGBa0145M07.7 [Oryza sativa Indica Group] Length = 1087 Score = 60.1 bits (144), Expect = 2e-07 Identities = 30/70 (42%), Positives = 39/70 (55%) Frame = -2 Query: 222 TRQRDGTLRPVQRTDGTIRWPPPRAYTAQLSTNLEEPTCHSQAVWFPKWRNTMTNEFNAL 43 TR + +P+ RTDGTIRW S + +EPTC A+ W+ M E+NAL Sbjct: 609 TRLQSNIRKPLTRTDGTIRW-------GMYSGSDKEPTCFDDALADENWKKAMDEEYNAL 661 Query: 42 LKNWTWFLVP 13 +KN TW LVP Sbjct: 662 IKNNTWHLVP 671 >emb|CAN66999.1| hypothetical protein VITISV_019171 [Vitis vinifera] Length = 955 Score = 54.7 bits (130), Expect = 8e-06 Identities = 29/75 (38%), Positives = 38/75 (50%) Frame = -2 Query: 234 HHYGTRQRDGTLRPVQRTDGTIRWPPPRAYTAQLSTNLEEPTCHSQAVWFPKWRNTMTNE 55 HH TR ++G +P + YT L N+EEP +A+ PKW+ M E Sbjct: 513 HHMVTRSKNGIFKP-------------KVYTVDL--NVEEPNTFQEAISHPKWKEAMDEE 557 Query: 54 FNALLKNWTWFLVPL 10 F AL+KN TW LV L Sbjct: 558 FRALMKNKTWSLVSL 572