BLASTX nr result
ID: Cimicifuga21_contig00028494
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00028494 (334 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003634944.1| PREDICTED: pentatricopeptide repeat-containi... 92 4e-17 ref|XP_002325952.1| predicted protein [Populus trichocarpa] gi|2... 87 1e-15 ref|XP_002525536.1| pentatricopeptide repeat-containing protein,... 73 3e-11 ref|XP_004141361.1| PREDICTED: pentatricopeptide repeat-containi... 68 9e-10 ref|XP_003637044.1| Pentatricopeptide repeat-containing protein ... 59 5e-07 >ref|XP_003634944.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial-like [Vitis vinifera] Length = 582 Score = 92.0 bits (227), Expect = 4e-17 Identities = 44/92 (47%), Positives = 62/92 (67%) Frame = +2 Query: 59 ERSQEIVEVIKRDEKDMENELNKMGLALSLDLISEVFAGLNADRVSGLRFFKWVREKQVH 238 +R EI++VI+ DE DME +LN M L LS+ ++E+F LN +R+S +RFF+W+ + Sbjct: 204 KRISEIIKVIRSDEIDMEVKLNLMNLRLSVASVTEIFRVLNLERLSAMRFFEWISHSRSG 263 Query: 239 FCRNSDFCSLAIDNLGRIEDYNSMLLTLKDFS 334 RN D CSL IDN GR+ DY +M LKDF+ Sbjct: 264 LSRNYDICSLIIDNCGRLGDYETMRCLLKDFN 295 >ref|XP_002325952.1| predicted protein [Populus trichocarpa] gi|222862827|gb|EEF00334.1| predicted protein [Populus trichocarpa] Length = 432 Score = 87.4 bits (215), Expect = 1e-15 Identities = 41/93 (44%), Positives = 64/93 (68%) Frame = +2 Query: 56 QERSQEIVEVIKRDEKDMENELNKMGLALSLDLISEVFAGLNADRVSGLRFFKWVREKQV 235 Q++ I+++IKRDE D+E +L + + LS+ ++ VF LN+++VS LRFF+W+R Q Sbjct: 59 QKQVAYIIDLIKRDEYDLEYKLGSLSVKLSIASVTLVFHVLNSEKVSALRFFRWIRHWQP 118 Query: 236 HFCRNSDFCSLAIDNLGRIEDYNSMLLTLKDFS 334 NSD CSL IDN GR++DY++M L +F+ Sbjct: 119 ELRCNSDICSLVIDNCGRLDDYDAMRSLLNEFN 151 >ref|XP_002525536.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223535215|gb|EEF36894.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 430 Score = 72.8 bits (177), Expect = 3e-11 Identities = 34/87 (39%), Positives = 53/87 (60%) Frame = +2 Query: 74 IVEVIKRDEKDMENELNKMGLALSLDLISEVFAGLNADRVSGLRFFKWVREKQVHFCRNS 253 I+ ++ ++ ++E +LN +G+ LS+ + VF LN ++ S L+FF W+R Q NS Sbjct: 64 IIGLLITEDNELETKLNSLGVRLSIGSVRWVFQVLNREKKSALQFFHWIRRWQPELEGNS 123 Query: 254 DFCSLAIDNLGRIEDYNSMLLTLKDFS 334 D CSL IDN G ++DY +M L FS Sbjct: 124 DICSLVIDNCGHLDDYKAMRCLLDGFS 150 >ref|XP_004141361.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Cucumis sativus] gi|449498723|ref|XP_004160616.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Cucumis sativus] Length = 494 Score = 67.8 bits (164), Expect = 9e-10 Identities = 36/110 (32%), Positives = 61/110 (55%) Frame = +2 Query: 2 KSQISREKSDFSKSGSRNQERSQEIVEVIKRDEKDMENELNKMGLALSLDLISEVFAGLN 181 K Q + SK + + S I+ +I+ +++D+E++L+ + L+ L+ ++ LN Sbjct: 99 KRQCGTGNLNVSKRNVTSNQLSN-IINIIRENQEDLESKLDSPNVRLTNVLVGQILEMLN 157 Query: 182 ADRVSGLRFFKWVREKQVHFCRNSDFCSLAIDNLGRIEDYNSMLLTLKDF 331 ++S RFF WV + F NSD SL IDN GR++DY +L L +F Sbjct: 158 KHKISASRFFNWVSVQSCKFPCNSDVYSLLIDNFGRLDDYEGILPVLIEF 207 >ref|XP_003637044.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|358346621|ref|XP_003637365.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355502979|gb|AES84182.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355503300|gb|AES84503.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 448 Score = 58.5 bits (140), Expect = 5e-07 Identities = 31/100 (31%), Positives = 56/100 (56%) Frame = +2 Query: 35 SKSGSRNQERSQEIVEVIKRDEKDMENELNKMGLALSLDLISEVFAGLNADRVSGLRFFK 214 +K + +++ SQ I VI+ D +E+ LN M ++LS+ + +F L + RVS L FF Sbjct: 70 NKPYATSKQVSQIIAMVIEGDN-GLEHRLNMMNVSLSMASVIYIFDALASQRVSALMFFH 128 Query: 215 WVREKQVHFCRNSDFCSLAIDNLGRIEDYNSMLLTLKDFS 334 W+ C + + +DN G + D+++M+ L+DF+ Sbjct: 129 WLNVSHPELCCDPEIGCCVVDNCGLLRDFDAMVPILRDFN 168