BLASTX nr result
ID: Cimicifuga21_contig00028403
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00028403 (339 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004162287.1| PREDICTED: pentatricopeptide repeat-containi... 74 9e-12 ref|XP_004144640.1| PREDICTED: pentatricopeptide repeat-containi... 74 9e-12 gb|ADN33755.1| pentatricopeptide repeat-containing protein [Cucu... 72 5e-11 ref|XP_002269984.1| PREDICTED: pentatricopeptide repeat-containi... 70 2e-10 ref|XP_002513427.1| pentatricopeptide repeat-containing protein,... 67 1e-09 >ref|XP_004162287.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like [Cucumis sativus] Length = 566 Score = 74.3 bits (181), Expect = 9e-12 Identities = 34/54 (62%), Positives = 44/54 (81%) Frame = -1 Query: 171 LLHTVSPLSNPTSITTKKACCFISQIPNLHTLSLNKGFSKILASTHISIPPKET 10 LL+TVSP++NP+ TT++ C F S IPN+ LSLNKGFSK+LAST I+I PK+T Sbjct: 4 LLNTVSPITNPSPETTRRGCGFFSHIPNIQKLSLNKGFSKVLASTQITISPKDT 57 >ref|XP_004144640.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like [Cucumis sativus] Length = 566 Score = 74.3 bits (181), Expect = 9e-12 Identities = 34/54 (62%), Positives = 44/54 (81%) Frame = -1 Query: 171 LLHTVSPLSNPTSITTKKACCFISQIPNLHTLSLNKGFSKILASTHISIPPKET 10 LL+TVSP++NP+ TT++ C F S IPN+ LSLNKGFSK+LAST I+I PK+T Sbjct: 4 LLNTVSPITNPSPETTRRGCGFFSHIPNIQKLSLNKGFSKVLASTQITISPKDT 57 >gb|ADN33755.1| pentatricopeptide repeat-containing protein [Cucumis melo subsp. melo] Length = 566 Score = 72.0 bits (175), Expect = 5e-11 Identities = 34/54 (62%), Positives = 43/54 (79%) Frame = -1 Query: 171 LLHTVSPLSNPTSITTKKACCFISQIPNLHTLSLNKGFSKILASTHISIPPKET 10 LL+TVSP++N + TT++ C F S IPNL LSLNKGFSK+LAST I+I PK+T Sbjct: 4 LLNTVSPITNTSPETTRRGCGFFSHIPNLQKLSLNKGFSKVLASTQITISPKDT 57 >ref|XP_002269984.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic [Vitis vinifera] gi|147852271|emb|CAN82234.1| hypothetical protein VITISV_038804 [Vitis vinifera] Length = 567 Score = 70.1 bits (170), Expect = 2e-10 Identities = 30/53 (56%), Positives = 43/53 (81%) Frame = -1 Query: 171 LLHTVSPLSNPTSITTKKACCFISQIPNLHTLSLNKGFSKILASTHISIPPKE 13 L++ +SP+++P+ +K C F SQ+PNLHTLSLNKGFS++LAST I+I PK+ Sbjct: 4 LVNAMSPITSPSPENARKVCGFFSQVPNLHTLSLNKGFSRVLASTQITISPKD 56 >ref|XP_002513427.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223547335|gb|EEF48830.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 567 Score = 67.4 bits (163), Expect = 1e-09 Identities = 30/55 (54%), Positives = 43/55 (78%) Frame = -1 Query: 174 ALLHTVSPLSNPTSITTKKACCFISQIPNLHTLSLNKGFSKILASTHISIPPKET 10 +L+H+VSPL+NP + + AC F S IPNLH+ SLNK F+++LAST I+I PK++ Sbjct: 3 SLVHSVSPLTNPFTEAARIACGFFSHIPNLHSFSLNKDFTRVLASTQITISPKDS 57