BLASTX nr result
ID: Cimicifuga21_contig00028333
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00028333 (280 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA65995.1| hypothetical protein [Beta vulgaris subsp. vulga... 61 8e-08 >emb|CCA65995.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1389 Score = 61.2 bits (147), Expect = 8e-08 Identities = 29/74 (39%), Positives = 40/74 (54%) Frame = -3 Query: 278 AKRRPFRFEAMWLDHPDWLAEVDKALCQDFYGSCSFRFCQLLKLCKTNLISWNKSCFGHL 99 +K PFRFE MW D+ + V + C FYGS F F Q KL K N WNK+ FG++ Sbjct: 242 SKAPPFRFEKMWCTRKDYDSLVKRTWCTKFYGSHMFNFVQKCKLVKINSKEWNKTQFGNI 301 Query: 98 VSRLNEVQASINRL 57 +L +V + + Sbjct: 302 FRQLRQVDERLEEI 315